GlyCosmos Portal

Submissions

Ras-related protein Rab-8B

Summary

UniProt ID: P61028
Gene Symbol: Rab8b
Gene ID: 235442
Organism: Mus musculus (house mouse)

External Links

GlyGen: P61028
RaftProt: P61028
Re-Glyco: P61028

Annotation

Keyword: Cell membrane Cytoplasmic vesicle Endosome GTP-binding Hydrolase Magnesium Metal-binding Methylation Phosphoprotein Prenylation Protein transport Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
exocytosis	IBA	GO_REF
antigen processing and presentation	ISO	GO_REF
antigen processing and presentation	IEA	GO_REF
positive regulation of cell projection organization	ISO	GO_REF
endocytic recycling	IBA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

antigen processing and presentation

cellular process [inference]

vesicle-mediated transport [inference]

exocytosis

endosomal transport [inference]

endocytic recycling

vesicle-mediated transport to the plasma membrane [inference]

endocytic recycling

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into peroxisome membrane

endosomal transport [inference]

endocytic recycling

peroxisomal transport [inference]

peroxisomal membrane transport [inference]

protein import into peroxisome membrane

localization within membrane [inference]

protein localization to membrane [inference]

protein import into peroxisome membrane

establishment of protein localization to membrane [inference]

protein import into peroxisome membrane

vesicle-mediated transport to the plasma membrane [inference]

endocytic recycling

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

peroxisome organization [inference]

protein localization to peroxisome [inference]

protein import into peroxisome membrane

cell junction organization [inference]

cell-substrate junction organization

export from cell [inference]

secretion by cell [inference]

exocytosis

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein import into peroxisome membrane

protein localization to organelle [inference]

protein localization to peroxisome [inference]

protein import into peroxisome membrane

protein localization to membrane [inference]

protein import into peroxisome membrane

establishment of localization [inference]

transport [inference]

protein transport [inference]

intracellular protein transport [inference]

protein import into peroxisome membrane

vesicle-mediated transport [inference]

exocytosis

endosomal transport [inference]

endocytic recycling

vesicle-mediated transport to the plasma membrane [inference]

endocytic recycling

secretion [inference]

secretion by cell [inference]

exocytosis

intracellular transport [inference]

intracellular protein transport [inference]

protein import into peroxisome membrane

endosomal transport [inference]

endocytic recycling

peroxisomal transport [inference]

peroxisomal membrane transport [inference]

protein import into peroxisome membrane

export from cell [inference]

secretion by cell [inference]

exocytosis

establishment of protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein import into peroxisome membrane

establishment of protein localization to organelle [inference]

establishment of protein localization to peroxisome [inference]

protein import into peroxisome membrane

establishment of protein localization to membrane [inference]

protein import into peroxisome membrane

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into peroxisome membrane

endosomal transport [inference]

endocytic recycling

peroxisomal transport [inference]

peroxisomal membrane transport [inference]

protein import into peroxisome membrane

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into peroxisome membrane

endosomal transport [inference]

endocytic recycling

peroxisomal transport [inference]

peroxisomal membrane transport [inference]

protein import into peroxisome membrane

localization within membrane [inference]

protein localization to membrane [inference]

protein import into peroxisome membrane

establishment of protein localization to membrane [inference]

protein import into peroxisome membrane

vesicle-mediated transport to the plasma membrane [inference]

endocytic recycling

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

positive regulation of signaling [inference]

positive regulation of hormone secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

regulation of hormone secretion [inference]

positive regulation of hormone secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

regulation of peptide hormone secretion [inference]

regulation of corticotropin secretion [inference]

positive regulation of corticotropin secretion

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

regulation of peptide secretion [inference]

positive regulation of peptide secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

regulation of peptide hormone secretion [inference]

regulation of corticotropin secretion [inference]

positive regulation of corticotropin secretion

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

positive regulation of secretion [inference]

positive regulation of peptide secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

positive regulation of secretion by cell [inference]

positive regulation of hormone secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

positive regulation of hormone secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

regulation of peptide hormone secretion [inference]

regulation of corticotropin secretion [inference]

positive regulation of corticotropin secretion

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

positive regulation of secretion by cell [inference]

positive regulation of hormone secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of peptide secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

positive regulation of secretion by cell [inference]

positive regulation of hormone secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

regulation of peptide transport [inference]

regulation of peptide secretion [inference]

positive regulation of peptide secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

regulation of peptide hormone secretion [inference]

regulation of corticotropin secretion [inference]

positive regulation of corticotropin secretion

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of hormone secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of hormone secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization

positive regulation of secretion by cell [inference]

positive regulation of hormone secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of peptide secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

positive regulation of secretion by cell [inference]

positive regulation of hormone secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

positive regulation of multicellular organismal process [inference]

positive regulation of corticotropin secretion

regulation of cellular process [inference]

regulation of cell communication [inference]

positive regulation of cell communication [inference]

positive regulation of hormone secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

regulation of hormone secretion [inference]

positive regulation of hormone secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

regulation of peptide hormone secretion [inference]

regulation of corticotropin secretion [inference]

positive regulation of corticotropin secretion

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of hormone secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization

positive regulation of secretion by cell [inference]

positive regulation of hormone secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

positive regulation of cell projection organization

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

positive regulation of hormone secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

regulation of peptide hormone secretion [inference]

regulation of corticotropin secretion [inference]

positive regulation of corticotropin secretion

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

positive regulation of secretion by cell [inference]

positive regulation of hormone secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of endocrine process [inference]

regulation of corticotropin secretion [inference]

positive regulation of corticotropin secretion

positive regulation of multicellular organismal process [inference]

positive regulation of corticotropin secretion

regulation of biological quality [inference]

regulation of hormone levels [inference]

regulation of hormone secretion [inference]

positive regulation of hormone secretion [inference]

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

regulation of peptide hormone secretion [inference]

regulation of corticotropin secretion [inference]

positive regulation of corticotropin secretion

positive regulation of peptide hormone secretion [inference]

positive regulation of corticotropin secretion

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrion	HDA	PMID
endosome	IBA	GO_REF
peroxisomal membrane	ISO	GO_REF
peroxisomal membrane	IEA	GO_REF
plasma membrane	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane

endocytic vesicle membrane [inference]

phagocytic vesicle membrane

bounding membrane of organelle [inference]

endosome membrane

endocytic vesicle membrane [inference]

phagocytic vesicle membrane

microbody membrane [inference]

peroxisomal membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

Golgi-associated vesicle [inference]

trans-Golgi network transport vesicle

transport vesicle [inference]

trans-Golgi network transport vesicle

exocytic vesicle [inference]

synaptic vesicle

coated vesicle [inference]

clathrin-coated vesicle [inference]

trans-Golgi network transport vesicle

endocytic vesicle [inference]

phagocytic vesicle

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

Golgi-associated vesicle [inference]

trans-Golgi network transport vesicle

transport vesicle [inference]

trans-Golgi network transport vesicle

exocytic vesicle [inference]

synaptic vesicle

coated vesicle [inference]

clathrin-coated vesicle [inference]

trans-Golgi network transport vesicle

endocytic vesicle [inference]

phagocytic vesicle

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

Golgi-associated vesicle [inference]

trans-Golgi network transport vesicle

transport vesicle [inference]

trans-Golgi network transport vesicle

exocytic vesicle [inference]

synaptic vesicle

coated vesicle [inference]

clathrin-coated vesicle [inference]

trans-Golgi network transport vesicle

endocytic vesicle [inference]

phagocytic vesicle

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

perinuclear region of cytoplasm

cell pole [inference]

cell tip

presynapse

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
GTPase activity	ISS	GO_REF
GTPase activity	IBA	GO_REF
GTPase activity	IEA	GO_REF
G protein activity	IEA	GO_REF
signaling receptor binding	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity [inference]

GTPase activity

G protein activity

binding [inference]

protein binding [inference]

signaling receptor binding

protein domain specific binding [inference]

TPR domain binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

GDP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

cation binding [inference]

metal ion binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

purine ribonucleoside triphosphate binding [inference]

GTP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

purine ribonucleoside triphosphate binding [inference]

GTP binding

molecular function regulator activity [inference]

G protein activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFFTLARDIMTKLNRKMNDSNSSGAGGPVKITESRSKKTSFFRCSLL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites