GlyCosmos Portal

Submissions

ATP-binding cassette sub-family E member 1

Summary

UniProt ID

P61222

Gene Symbol

Abce1
Rli

Gene ID

24015

Organism

Mus musculus (house mouse)

External Links

GlyGen: P61222
PubChem: P61222
RaftProt: P61222
Re-Glyco: P61222

Annotation

Keyword: 4Fe-4S ATP-binding Chaperone Cytoplasm Hydrolase Mitochondrion Phosphoprotein Reference proteome Repeat Translation regulation Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
translational initiation	IBA	GO_REF
translational termination	ISO	GO_REF
translational termination	IBA	GO_REF
translational termination	IEA	GO_REF
regulation of translation

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

translational initiation

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

ribosome-associated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

ribosome-associated ubiquitin-dependent protein catabolic process

modification-dependent macromolecule catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

ribosome-associated ubiquitin-dependent protein catabolic process

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

translational elongation [inference]

cytoplasmic translational elongation [inference]

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

ribosome-associated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

ribosome-associated ubiquitin-dependent protein catabolic process

modification-dependent macromolecule catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

ribosome-associated ubiquitin-dependent protein catabolic process

macromolecule biosynthetic process [inference]

translational elongation [inference]

cytoplasmic translational elongation [inference]

protein metabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

ribosome-associated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

ribosome-associated ubiquitin-dependent protein catabolic process

protein modification process [inference]

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein ufmylation

macromolecule modification [inference]

protein modification process [inference]

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein ufmylation

primary metabolic process [inference]

protein metabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

ribosome-associated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process [inference]

ribosome-associated ubiquitin-dependent protein catabolic process

protein modification process [inference]

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein ufmylation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

organelle disassembly [inference]

ribosome disassembly

rescue of stalled cytosolic ribosome

cellular component disassembly [inference]

protein-containing complex disassembly [inference]

translational termination

organelle disassembly [inference]

ribosome disassembly

rescue of stalled cytosolic ribosome

protein-containing complex organization [inference]

protein-containing complex disassembly [inference]

translational termination

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

post-transcriptional regulation of gene expression [inference]

regulation of translation

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

post-transcriptional regulation of gene expression [inference]

regulation of translation

regulation of protein metabolic process [inference]

regulation of translation

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of translation

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	ISS	GO_REF
cytoplasm	ISO	GO_REF
cytoplasm	IEA	GO_REF GO_REF GO_REF
mitochondrion	ISS	GO_REF
mitochondrion	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

membraneless organelle [inference]

intracellular membraneless organelle [inference]

ribosome [inference]

cytosolic ribosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular membraneless organelle [inference]

ribosome [inference]

cytosolic ribosome

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
GTPase activity	ISS	GO_REF
GTPase activity	ISO	GO_REF
GTPase activity	IEA	GO_REF
iron ion binding	IBA	GO_REF
ATP binding	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

iron ion binding

metal cluster binding [inference]

iron-sulfur cluster binding [inference]

4 iron, 4 sulfur cluster binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

protein-containing complex binding [inference]

ribonucleoprotein complex binding [inference]

ribosome binding [inference]

ribosomal small subunit binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity [inference]

nuclease inhibitor activity [inference]

ribonuclease inhibitor activity [inference]

endoribonuclease inhibitor activity

molecular function inhibitor activity [inference]

enzyme inhibitor activity [inference]

nuclease inhibitor activity [inference]

ribonuclease inhibitor activity [inference]

endoribonuclease inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINPDRYIIVVEHDLSVLDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKSTGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites