GlyCosmos Portal

Submissions

Metalloproteinase inhibitor 3

Summary

UniProt ID

P61269

Gene Symbol

TIMP3

Gene ID

102141270

Organism

Macaca fascicularis (crab-eating macaque)

External Links

PubChem: P61269
Re-Glyco: P61269

Annotation

Keyword: Disulfide bond Extracellular matrix Glycoprotein Metal-binding Metalloprotease inhibitor Reference proteome Signal Zinc

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
response to hormone	IEA	GO_REF
negative regulation of extracellular matrix disassembly	IEA	GO_REF
response to cytokine	IEA	GO_REF
negative regulation of membrane protein ectodomain proteolysis	IEA	GO_REF GO_REF

GO Hierarchy

biological process

response to stimulus [inference]

response to endogenous stimulus [inference]

response to hormone

response to chemical [inference]

response to hormone

response to peptide [inference]

response to cytokine

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of cellular component organization [inference]

negative regulation of extracellular matrix organization [inference]

negative regulation of extracellular matrix disassembly

regulation of cellular process [inference]

regulation of metabolic process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of catabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

negative regulation of proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

negative regulation of proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of cellular component organization [inference]

negative regulation of extracellular matrix organization [inference]

negative regulation of extracellular matrix disassembly

regulation of cellular component organization [inference]

negative regulation of cellular component organization [inference]

negative regulation of extracellular matrix organization [inference]

negative regulation of extracellular matrix disassembly

regulation of extracellular matrix organization [inference]

regulation of extracellular matrix disassembly [inference]

negative regulation of extracellular matrix disassembly

negative regulation of extracellular matrix organization [inference]

negative regulation of extracellular matrix disassembly

Displaying **all 3** entries
GO Term	Evidence Code	Reference
basement membrane	IEA	GO_REF
obsolete extracellular space
secretory granule lumen	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

external encapsulating structure [inference]

extracellular matrix [inference]

basement membrane

membrane-enclosed lumen [inference]

organelle lumen [inference]

vesicle lumen [inference]

cytoplasmic vesicle lumen [inference]

secretory granule lumen

intracellular organelle lumen [inference]

cytoplasmic vesicle lumen [inference]

secretory granule lumen

Displaying **all 3** entries
GO Term	Evidence Code	Reference
protease binding	IEA	GO_REF
metalloendopeptidase inhibitor activity	IEA	GO_REF GO_REF
zinc ion binding	ISS	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

enzyme binding [inference]

protease binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

peptidase regulator activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

endopeptidase regulator activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

molecular function inhibitor activity [inference]

enzyme inhibitor activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites