GlyCosmos Portal

Submissions

Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

Summary

UniProt ID: P62137
Gene Symbol: Ppp1ca Ppp1a
Gene ID: 19045
Organism: Mus musculus (house mouse)

External Links

GlyGen: P62137
PubChem: P62137
RaftProt: P62137
Re-Glyco: P62137

Annotation

Keyword: 3D-structure Acetylation Biological rhythms Cell division Cytoplasm Direct protein sequencing Glycogen metabolism Manganese Metal-binding Nucleus Phosphoprotein Protein phosphatase Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 43 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
telomere maintenance	ISO	GO_REF
RNA polymerase II promoter clearance	ISS	GO_REF
RNA polymerase II promoter clearance	ISO	GO_REF
RNA polymerase II promoter clearance	IEA	GO_REF
glycogen metabolic process	TAS	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

generation of precursor metabolites and energy [inference]

energy derivation by oxidation of organic compounds [inference]

energy reserve metabolic process [inference]

glycogen metabolic process

phosphate-containing compound metabolic process [inference]

dephosphorylation [inference]

protein dephosphorylation

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

promoter clearance during DNA-templated transcription [inference]

RNA polymerase II promoter clearance

DNA-templated transcription [inference]

transcription by RNA polymerase II

DNA-templated transcription elongation [inference]

transcription elongation by RNA polymerase II

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

promoter clearance during DNA-templated transcription [inference]

RNA polymerase II promoter clearance

DNA-templated transcription [inference]

transcription by RNA polymerase II

DNA-templated transcription elongation [inference]

transcription elongation by RNA polymerase II

macromolecule metabolic process [inference]

polysaccharide metabolic process [inference]

glucan metabolic process [inference]

glycogen metabolic process

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

promoter clearance during DNA-templated transcription [inference]

RNA polymerase II promoter clearance

DNA-templated transcription [inference]

transcription by RNA polymerase II

DNA-templated transcription elongation [inference]

transcription elongation by RNA polymerase II

protein metabolic process [inference]

protein modification process [inference]

protein dephosphorylation

macromolecule modification [inference]

protein modification process [inference]

protein dephosphorylation

nucleic acid metabolic process [inference]

DNA metabolic process [inference]

telomere maintenance

telomere maintenance in response to DNA damage

DNA repair [inference]

double-strand break repair [inference]

double-strand break repair via nonhomologous end joining [inference]

double-strand break repair via alternative nonhomologous end joining

RNA metabolic process [inference]

RNA biosynthetic process [inference]

promoter clearance during DNA-templated transcription [inference]

RNA polymerase II promoter clearance

DNA-templated transcription [inference]

transcription by RNA polymerase II

DNA-templated transcription elongation [inference]

transcription elongation by RNA polymerase II

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

promoter clearance during DNA-templated transcription [inference]

RNA polymerase II promoter clearance

DNA-templated transcription [inference]

transcription by RNA polymerase II

DNA-templated transcription elongation [inference]

transcription elongation by RNA polymerase II

primary metabolic process [inference]

carbohydrate metabolic process [inference]

polysaccharide metabolic process [inference]

glucan metabolic process [inference]

glycogen metabolic process

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

promoter clearance during DNA-templated transcription [inference]

RNA polymerase II promoter clearance

DNA-templated transcription [inference]

transcription by RNA polymerase II

DNA-templated transcription elongation [inference]

transcription elongation by RNA polymerase II

nucleic acid metabolic process [inference]

DNA metabolic process [inference]

telomere maintenance

telomere maintenance in response to DNA damage

DNA repair [inference]

double-strand break repair [inference]

double-strand break repair via nonhomologous end joining [inference]

double-strand break repair via alternative nonhomologous end joining

RNA metabolic process [inference]

RNA biosynthetic process [inference]

promoter clearance during DNA-templated transcription [inference]

RNA polymerase II promoter clearance

DNA-templated transcription [inference]

transcription by RNA polymerase II

DNA-templated transcription elongation [inference]

transcription elongation by RNA polymerase II

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

promoter clearance during DNA-templated transcription [inference]

RNA polymerase II promoter clearance

DNA-templated transcription [inference]

transcription by RNA polymerase II

DNA-templated transcription elongation [inference]

transcription elongation by RNA polymerase II

protein metabolic process [inference]

protein modification process [inference]

protein dephosphorylation

cell division

cellular response to stimulus [inference]

cellular response to stress [inference]

DNA damage response [inference]

DNA repair [inference]

double-strand break repair [inference]

double-strand break repair via nonhomologous end joining [inference]

double-strand break repair via alternative nonhomologous end joining

telomere maintenance in response to DNA damage

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

chromosome organization [inference]

telomere organization [inference]

telomere maintenance

telomere maintenance in response to DNA damage

multicellular organismal process [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube

developmental process [inference]

anatomical structure morphogenesis [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube

tube morphogenesis [inference]

branching morphogenesis of an epithelial tube

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube

anatomical structure development [inference]

animal gross anatomical part developmental process [inference]

animal organ development [inference]

lung development

rhythmic process [inference]

circadian rhythm [inference]

circadian regulation of gene expression

response to stimulus [inference]

response to stress [inference]

cellular response to stress [inference]

DNA damage response [inference]

DNA repair [inference]

double-strand break repair [inference]

double-strand break repair via nonhomologous end joining [inference]

double-strand break repair via alternative nonhomologous end joining

telomere maintenance in response to DNA damage

response to external stimulus [inference]

entrainment of circadian clock [inference]

entrainment of circadian clock by photoperiod

response to abiotic stimulus [inference]

response to radiation [inference]

response to light stimulus [inference]

photoperiodism [inference]

entrainment of circadian clock by photoperiod

response to chemical [inference]

response to metal ion [inference]

response to lead ion

cellular response to stimulus [inference]

cellular response to stress [inference]

DNA damage response [inference]

DNA repair [inference]

double-strand break repair [inference]

double-strand break repair via nonhomologous end joining [inference]

double-strand break repair via alternative nonhomologous end joining

telomere maintenance in response to DNA damage

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of circadian rhythm

entrainment of circadian clock [inference]

entrainment of circadian clock by photoperiod

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

positive regulation of glycogen metabolic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of carbohydrate metabolic process [inference]

positive regulation of glucose metabolic process [inference]

positive regulation of glycogen metabolic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of small molecule metabolic process [inference]

positive regulation of glucose metabolic process [inference]

positive regulation of glycogen metabolic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of cellular component organization [inference]

positive regulation of protein-containing complex disassembly [inference]

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process [inference]

negative regulation of triglyceride catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

negative regulation of lipid metabolic process [inference]

negative regulation of lipid catabolic process [inference]

negative regulation of triglyceride catabolic process

negative regulation of triglyceride metabolic process [inference]

negative regulation of triglyceride catabolic process

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of DNA-templated transcription elongation [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of transcription elongation by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

post-transcriptional regulation of gene expression [inference]

regulation of translation

circadian regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

regulation of polysaccharide biosynthetic process [inference]

regulation of glucan biosynthetic process [inference]

regulation of glycogen biosynthetic process

positive regulation of glycogen biosynthetic process

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of DNA-templated transcription elongation [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of transcription elongation by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of termination of RNA polymerase II transcription, poly(A)-coupled [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of carbohydrate biosynthetic process [inference]

regulation of polysaccharide biosynthetic process [inference]

regulation of glucan biosynthetic process [inference]

regulation of glycogen biosynthetic process

positive regulation of glycogen biosynthetic process

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process [inference]

negative regulation of triglyceride catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

negative regulation of lipid metabolic process [inference]

negative regulation of lipid catabolic process [inference]

negative regulation of triglyceride catabolic process

negative regulation of triglyceride metabolic process [inference]

negative regulation of triglyceride catabolic process

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

positive regulation of glycogen metabolic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of carbohydrate metabolic process [inference]

positive regulation of glucose metabolic process [inference]

positive regulation of glycogen metabolic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of small molecule metabolic process [inference]

positive regulation of glucose metabolic process [inference]

positive regulation of glycogen metabolic process [inference]

positive regulation of glycogen biosynthetic process

regulation of catabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process [inference]

negative regulation of triglyceride catabolic process

regulation of carbohydrate catabolic process [inference]

regulation of glycogen catabolic process

regulation of lipid catabolic process [inference]

regulation of triglyceride catabolic process [inference]

negative regulation of triglyceride catabolic process

negative regulation of lipid catabolic process [inference]

negative regulation of triglyceride catabolic process

regulation of generation of precursor metabolites and energy [inference]

regulation of glycogen metabolic process [inference]

regulation of glycogen biosynthetic process

positive regulation of glycogen biosynthetic process

regulation of glycogen catabolic process

positive regulation of glycogen metabolic process [inference]

positive regulation of glycogen biosynthetic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of DNA-templated transcription elongation [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of transcription elongation by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

post-transcriptional regulation of gene expression [inference]

regulation of translation

circadian regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

regulation of polysaccharide biosynthetic process [inference]

regulation of glucan biosynthetic process [inference]

regulation of glycogen biosynthetic process

positive regulation of glycogen biosynthetic process

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of DNA-templated transcription elongation [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of transcription elongation by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of termination of RNA polymerase II transcription, poly(A)-coupled [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

positive regulation of glycogen metabolic process [inference]

positive regulation of glycogen biosynthetic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

regulation of polysaccharide metabolic process [inference]

regulation of polysaccharide biosynthetic process [inference]

regulation of glucan biosynthetic process [inference]

regulation of glycogen biosynthetic process

positive regulation of glycogen biosynthetic process

regulation of glycogen metabolic process [inference]

regulation of glycogen biosynthetic process

positive regulation of glycogen biosynthetic process

regulation of glycogen catabolic process

positive regulation of glycogen metabolic process [inference]

positive regulation of glycogen biosynthetic process

regulation of protein metabolic process [inference]

regulation of translation

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of DNA-templated transcription elongation [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of transcription elongation by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of termination of RNA polymerase II transcription, poly(A)-coupled [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of small molecule metabolic process [inference]

regulation of glucose metabolic process [inference]

positive regulation of glucose metabolic process [inference]

positive regulation of glycogen metabolic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of small molecule metabolic process [inference]

positive regulation of glucose metabolic process [inference]

positive regulation of glycogen metabolic process [inference]

positive regulation of glycogen biosynthetic process

regulation of primary metabolic process [inference]

regulation of carbohydrate metabolic process [inference]

regulation of glucose metabolic process [inference]

positive regulation of glucose metabolic process [inference]

positive regulation of glycogen metabolic process [inference]

positive regulation of glycogen biosynthetic process

regulation of polysaccharide metabolic process [inference]

regulation of polysaccharide biosynthetic process [inference]

regulation of glucan biosynthetic process [inference]

regulation of glycogen biosynthetic process

positive regulation of glycogen biosynthetic process

regulation of glycogen metabolic process [inference]

regulation of glycogen biosynthetic process

positive regulation of glycogen biosynthetic process

regulation of glycogen catabolic process

positive regulation of glycogen metabolic process [inference]

positive regulation of glycogen biosynthetic process

regulation of carbohydrate biosynthetic process [inference]

regulation of polysaccharide biosynthetic process [inference]

regulation of glucan biosynthetic process [inference]

regulation of glycogen biosynthetic process

positive regulation of glycogen biosynthetic process

regulation of carbohydrate catabolic process [inference]

regulation of glycogen catabolic process

positive regulation of carbohydrate metabolic process [inference]

positive regulation of glucose metabolic process [inference]

positive regulation of glycogen metabolic process [inference]

positive regulation of glycogen biosynthetic process

regulation of lipid metabolic process [inference]

negative regulation of lipid metabolic process [inference]

negative regulation of lipid catabolic process [inference]

negative regulation of triglyceride catabolic process

negative regulation of triglyceride metabolic process [inference]

negative regulation of triglyceride catabolic process

regulation of lipid catabolic process [inference]

regulation of triglyceride catabolic process [inference]

negative regulation of triglyceride catabolic process

negative regulation of lipid catabolic process [inference]

negative regulation of triglyceride catabolic process

regulation of triglyceride metabolic process [inference]

regulation of triglyceride catabolic process [inference]

negative regulation of triglyceride catabolic process

negative regulation of triglyceride metabolic process [inference]

negative regulation of triglyceride catabolic process

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of DNA-templated transcription elongation [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of transcription elongation by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of termination of RNA polymerase II transcription, poly(A)-coupled [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of protein metabolic process [inference]

regulation of translation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

positive regulation of glycogen metabolic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of carbohydrate metabolic process [inference]

positive regulation of glucose metabolic process [inference]

positive regulation of glycogen metabolic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of small molecule metabolic process [inference]

positive regulation of glucose metabolic process [inference]

positive regulation of glycogen metabolic process [inference]

positive regulation of glycogen biosynthetic process

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of cellular component organization [inference]

positive regulation of protein-containing complex disassembly [inference]

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

negative regulation of catabolic process [inference]

negative regulation of lipid catabolic process [inference]

negative regulation of triglyceride catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

negative regulation of lipid metabolic process [inference]

negative regulation of lipid catabolic process [inference]

negative regulation of triglyceride catabolic process

negative regulation of triglyceride metabolic process [inference]

negative regulation of triglyceride catabolic process

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription, elongation [inference]

negative regulation of transcription elongation by RNA polymerase II

regulation of cellular component organization [inference]

regulation of protein-containing complex disassembly [inference]

regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of termination of RNA polymerase II transcription, poly(A)-coupled [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

positive regulation of protein-containing complex disassembly [inference]

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

positive regulation of cellular component organization [inference]

positive regulation of protein-containing complex disassembly [inference]

positive regulation of termination of DNA-templated transcription [inference]

positive regulation of termination of RNA polymerase II transcription [inference]

positive regulation of termination of RNA polymerase II transcription, poly(A)-coupled

regulation of biological quality [inference]

regulation of protein stability [inference]

protein stabilization

Displaying entries **1 - 5** of 40 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
protein phosphatase type 1 complex	ISO	GO_REF GO_REF
protein phosphatase type 1 complex	IMP	PMID
protein phosphatase type 1 complex	IEA	GO_REF
chromosome, telomeric region	ISO	GO_REF
chromosome, telomeric region	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

catalytic complex [inference]

phosphatase complex [inference]

protein serine/threonine phosphatase complex [inference]

protein phosphatase type 1 complex

PTW/PP1 phosphatase complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

cell junction [inference]

synapse [inference]

glutamatergic synapse

anchoring junction [inference]

cell-cell junction [inference]

adherens junction

glycogen granule

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

neuron spine [inference]

dendritic spine

perikaryon

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

cell body [inference]

neuronal cell body

chromosomal region [inference]

chromosome, telomeric region

presynapse

postsynapse

dendritic spine

Displaying entries **1 - 5** of 28 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
phosphoprotein phosphatase activity	ISO	GO_REF GO_REF
phosphoprotein phosphatase activity	IDA	PMID
phosphoprotein phosphatase activity	IEA	GO_REF
protein serine/threonine phosphatase activity	ISS	PMID GO_REF
protein serine/threonine phosphatase activity	ISO	PMID GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

phosphoric ester hydrolase activity [inference]

phosphatase activity

phosphoprotein phosphatase activity

protein serine/threonine phosphatase activity

RNA polymerase II CTD heptapeptide repeat phosphatase activity [inference]

RNA polymerase II CTD heptapeptide repeat S5 phosphatase activity

catalytic activity, acting on a protein [inference]

phosphoprotein phosphatase activity

protein serine/threonine phosphatase activity

RNA polymerase II CTD heptapeptide repeat phosphatase activity [inference]

RNA polymerase II CTD heptapeptide repeat S5 phosphatase activity

RNA polymerase II CTD heptapeptide repeat modifying activity [inference]

RNA polymerase II CTD heptapeptide repeat phosphatase activity [inference]

RNA polymerase II CTD heptapeptide repeat S5 phosphatase activity

binding [inference]

protein binding [inference]

enzyme binding [inference]

phosphatase binding [inference]

protein phosphatase binding [inference]

protein phosphatase 1 binding

cell adhesion molecule binding [inference]

cadherin binding [inference]

cadherin binding involved in cell-cell adhesion

cell adhesion mediator activity [inference]

cell-cell adhesion mediator activity [inference]

cadherin binding involved in cell-cell adhesion

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding

iron ion binding

protein-containing complex binding

ribonucleoprotein complex binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
320				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
DARPP-32 events	Mus musculus
mRNA Polyadenylation	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements