GlyCosmos Portal

Submissions

Serine/threonine-protein phosphatase PP1-beta catalytic subunit

Summary

UniProt ID: P62141
Gene Symbol: Ppp1cb
Gene ID: 19046
Organism: Mus musculus (house mouse)

External Links

GlyGen: P62141
PubChem: P62141
RaftProt: P62141
Re-Glyco: P62141

Annotation

Keyword: Acetylation Biological rhythms Cell division Cytoplasm Direct protein sequencing Glycogen metabolism Manganese Metal-binding Nucleus Phosphoprotein Protein phosphatase Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
glycogen metabolic process
regulation of glycogen biosynthetic process	ISO	GO_REF
regulation of glycogen catabolic process	ISO	GO_REF
protein dephosphorylation	ISO	GO_REF
protein dephosphorylation	IDA	PMID PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

generation of precursor metabolites and energy [inference]

energy derivation by oxidation of organic compounds [inference]

energy reserve metabolic process [inference]

glycogen metabolic process

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

dephosphorylation [inference]

protein dephosphorylation

macromolecule metabolic process [inference]

polysaccharide metabolic process [inference]

glucan metabolic process [inference]

glycogen metabolic process

protein metabolic process [inference]

protein modification process [inference]

protein dephosphorylation

macromolecule modification [inference]

protein modification process [inference]

protein dephosphorylation

primary metabolic process [inference]

carbohydrate metabolic process [inference]

polysaccharide metabolic process [inference]

glucan metabolic process [inference]

glycogen metabolic process

protein metabolic process [inference]

protein modification process [inference]

protein dephosphorylation

cell division

rhythmic process [inference]

circadian rhythm [inference]

circadian regulation of gene expression

response to stimulus [inference]

response to external stimulus [inference]

entrainment of circadian clock [inference]

entrainment of circadian clock by photoperiod

response to abiotic stimulus [inference]

response to radiation [inference]

response to light stimulus [inference]

photoperiodism [inference]

entrainment of circadian clock by photoperiod

biological regulation [inference]

regulation of biological process [inference]

regulation of circadian rhythm

entrainment of circadian clock [inference]

entrainment of circadian clock by photoperiod

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

circadian regulation of gene expression

regulation of polysaccharide biosynthetic process [inference]

regulation of glucan biosynthetic process [inference]

regulation of glycogen biosynthetic process

regulation of carbohydrate biosynthetic process [inference]

regulation of polysaccharide biosynthetic process [inference]

regulation of glucan biosynthetic process [inference]

regulation of glycogen biosynthetic process

regulation of catabolic process [inference]

regulation of carbohydrate catabolic process [inference]

regulation of glycogen catabolic process

regulation of generation of precursor metabolites and energy [inference]

regulation of glycogen metabolic process [inference]

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

circadian regulation of gene expression

regulation of polysaccharide biosynthetic process [inference]

regulation of glucan biosynthetic process [inference]

regulation of glycogen biosynthetic process

regulation of polysaccharide metabolic process [inference]

regulation of polysaccharide biosynthetic process [inference]

regulation of glucan biosynthetic process [inference]

regulation of glycogen biosynthetic process

regulation of glycogen metabolic process [inference]

regulation of primary metabolic process [inference]

regulation of carbohydrate metabolic process [inference]

regulation of polysaccharide metabolic process [inference]

regulation of polysaccharide biosynthetic process [inference]

regulation of glucan biosynthetic process [inference]

regulation of glycogen biosynthetic process

regulation of glycogen metabolic process [inference]

regulation of carbohydrate biosynthetic process [inference]

regulation of polysaccharide biosynthetic process [inference]

regulation of glucan biosynthetic process [inference]

regulation of glycogen biosynthetic process

regulation of carbohydrate catabolic process [inference]

regulation of glycogen catabolic process

regulation of cell adhesion

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
protein phosphatase type 1 complex	ISO	GO_REF
chromosome, telomeric region	ISO	GO_REF
chromosome, telomeric region	IEA	GO_REF
nucleus	IEA	GO_REF
nucleoplasm	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

catalytic complex [inference]

phosphatase complex [inference]

protein serine/threonine phosphatase complex [inference]

protein phosphatase type 1 complex

PTW/PP1 phosphatase complex

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

nucleolus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

nucleolus

chromosomal region [inference]

chromosome, telomeric region

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
phosphoprotein phosphatase activity	ISO	GO_REF
phosphoprotein phosphatase activity	IEA	GO_REF
protein serine/threonine phosphatase activity	IDA	PMID
protein serine/threonine phosphatase activity	IEA	GO_REF GO_REF
phosphatase activity	IDA	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

phosphoric ester hydrolase activity [inference]

phosphatase activity

phosphoprotein phosphatase activity

protein serine/threonine phosphatase activity

myosin phosphatase activity

myosin-light-chain-phosphatase activity

catalytic activity, acting on a protein [inference]

phosphoprotein phosphatase activity

protein serine/threonine phosphatase activity

myosin phosphatase activity

myosin-light-chain-phosphatase activity

binding [inference]

protein binding [inference]

enzyme binding [inference]

kinase binding [inference]

protein kinase binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
316				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
RAF activation	Mus musculus
RHO GTPases activate PAKs	Mus musculus
RHO GTPases activate PKNs	Mus musculus
Regulation of PLK1 Activity at G2/M Transition	Mus musculus
mRNA Polyadenylation	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements