GlyCosmos Portal

Submissions

26S proteasome regulatory subunit 4

Summary

UniProt ID: P62192
Gene Symbol: Psmc1
Gene ID: 19179
Organism: Mus musculus (house mouse)

External Links

GlyGen: P62192
PubChem: P62192
O-GlcNAcAtlas: P62192
Re-Glyco: P62192

Annotation

Keyword: ATP-binding Acetylation Cytoplasm Isopeptide bond Membrane Myristate Nucleus Phosphoprotein Proteasome Reference proteome Ubl conjugation

Gene Ontology (GO)

Displaying 1 entry
GO Term	Evidence Code	Reference
proteasome-mediated ubiquitin-dependent protein catabolic process

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent macromolecule catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent macromolecule catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

protein metabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

primary metabolic process [inference]

protein metabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
proteasome complex	ISO	GO_REF
proteasome complex	IEA	GO_REF
nucleoplasm	ISO	GO_REF
nucleoplasm	IEA	GO_REF
cytosol	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

intracellular protein-containing complex [inference]

proteasome complex

catalytic complex [inference]

peptidase complex [inference]

endopeptidase complex [inference]

proteasome complex

cellular anatomical structure [inference]

Displaying **all 4** entries
GO Term	Evidence Code	Reference
ATP binding	IEA	GO_REF
ATP hydrolysis activity	IEA	GO_REF
TBP-class protein binding	ISO	GO_REF
proteasome-activating activity	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity [inference]

ATP hydrolysis activity

isomerase activity [inference]

macromolecular conformation isomerase activity [inference]

polypeptide conformation or assembly isomerase activity [inference]

proteasome-activating activity

binding [inference]

protein binding [inference]

transcription factor binding [inference]

general transcription initiation factor binding [inference]

TBP-class protein binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

ATP-dependent activity [inference]

proteasome-activating activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	GlyTouCan ID	Source
241	G02815KT	GlyGen
415	G49108TO	GlyGen
422	G49108TO	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 56 in total

1

2

3

4

5

6

Next ›

Last »
Pathway Name	Organism
ABC-family protein mediated transport	Mus musculus
AMPK-induced ERAD and lysosome mediated degradation of PD-L1(CD274)	Mus musculus
APC/C:Cdc20 mediated degradation of Securin	Mus musculus
APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1	Mus musculus
AUF1 (hnRNP D0) binds and destabilizes mRNA	Mus musculus
Activation of NF-kappaB in B cells	Mus musculus
Antigen processing: Ubiquitination & Proteasome degradation	Mus musculus
Assembly of the pre-replicative complex	Mus musculus
Asymmetric localization of PCP proteins	Mus musculus
Autodegradation of Cdh1 by Cdh1:APC/C	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements