GlyCosmos Portal

Submissions

Rho-related GTP-binding protein RhoB

Summary

UniProt ID: P62745
Gene Symbol: RHOB ARH6 ARHB
Gene ID: 388
Organism: Homo sapiens (human)

External Links

GlyGen: P62745
PubChem: P62745
Re-Glyco: P62745

Annotation

Keyword: 3D-structure ADP-ribosylation Angiogenesis Apoptosis Cell adhesion Cell membrane Developmental protein Differentiation Direct protein sequencing Endosome GTP-binding Glycoprotein Methylation Nucleus Palmitate Phosphoprotein Prenylation Protein transport Proteomics identification Reference proteome Tumor suppressor

Gene Ontology (GO)

Displaying entries **1 - 5** of 26 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
mitotic cytokinesis	IMP	PMID
mitotic cytokinesis	IEA	GO_REF
angiogenesis
intracellular protein transport
apoptotic process	TAS	PMID

GO Hierarchy

biological process

cellular process [inference]

cell adhesion

signal transduction

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction [inference]

Rho protein signal transduction

cell death [inference]

programmed cell death [inference]

apoptotic process

intercellular transport [inference]

endosome to lysosome transport

vesicle-mediated transport [inference]

endosome to lysosome transport

cell cycle process [inference]

cytokinesis [inference]

cytoskeleton-dependent cytokinesis [inference]

mitotic cytokinesis

mitotic cell cycle process [inference]

mitotic cytokinesis

cellular developmental process [inference]

cell differentiation

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport

vacuolar transport [inference]

lysosomal transport [inference]

endosome to lysosome transport

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

cellular response to oxygen-containing compound [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to ionizing radiation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

supramolecular fiber organization [inference]

actin filament organization

developmental process [inference]

anatomical structure morphogenesis [inference]

tube morphogenesis [inference]

epithelial tube morphogenesis [inference]

endothelial tube morphogenesis

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

morphogenesis of an endothelium [inference]

endothelial tube morphogenesis

epithelial tube morphogenesis [inference]

endothelial tube morphogenesis

anatomical structure formation involved in morphogenesis [inference]

angiogenesis

cellular developmental process [inference]

cell differentiation

response to stimulus [inference]

response to stress [inference]

response to oxidative stress [inference]

response to reactive oxygen species [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

response to hydrogen peroxide [inference]

cellular response to hydrogen peroxide

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

response to abiotic stimulus [inference]

response to radiation [inference]

response to ionizing radiation [inference]

cellular response to ionizing radiation

cellular response to radiation [inference]

cellular response to ionizing radiation

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to ionizing radiation

response to chemical [inference]

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

cellular response to oxygen-containing compound [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

response to oxygen-containing compound [inference]

response to reactive oxygen species [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

response to hydrogen peroxide [inference]

cellular response to hydrogen peroxide

cellular response to oxygen-containing compound [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

cellular response to oxygen-containing compound [inference]

cellular response to reactive oxygen species [inference]

cellular response to hydrogen peroxide

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to ionizing radiation

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

intracellular protein transport

establishment of localization [inference]

transport [inference]

intercellular transport [inference]

endosome to lysosome transport

protein transport [inference]

intracellular protein transport

vesicle-mediated transport [inference]

endosome to lysosome transport

intracellular transport [inference]

intracellular protein transport

vacuolar transport [inference]

lysosomal transport [inference]

endosome to lysosome transport

establishment of protein localization [inference]

protein transport [inference]

intracellular protein transport

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport

vacuolar transport [inference]

lysosomal transport [inference]

endosome to lysosome transport

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport

vacuolar transport [inference]

lysosomal transport [inference]

endosome to lysosome transport

biological regulation [inference]

regulation of biological process [inference]

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

regulation of cell motility [inference]

regulation of cell migration

regulation of endothelial cell migration [inference]

positive regulation of endothelial cell migration

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

positive regulation of biological process [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

positive regulation of cellular process [inference]

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

positive regulation of developmental process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

positive regulation of multicellular organismal process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

negative regulation of biological process [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of cellular process [inference]

negative regulation of cell cycle

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of developmental process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of cellular process [inference]

signal transduction

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction [inference]

Rho protein signal transduction

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of cellular process [inference]

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

negative regulation of cellular process [inference]

negative regulation of cell cycle

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cellular component organization [inference]

regulation of synapse organization [inference]

regulation of modification of synaptic structure [inference]

regulation of modification of postsynaptic structure

regulation of cell cycle [inference]

negative regulation of cell cycle

regulation of cell motility [inference]

regulation of cell migration

regulation of endothelial cell migration [inference]

positive regulation of endothelial cell migration

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of endothelial cell migration

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISS	GO_REF
nucleus	IEA	GO_REF GO_REF
early endosome	IEA	GO_REF
cytosol	TAS	Reactome Reactome
cytosol	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytosol

membrane [inference]

plasma membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane

late endosome membrane

bounding membrane of organelle [inference]

endosome membrane

late endosome membrane

plasma membrane region [inference]

cleavage furrow

cell junction [inference]

synapse [inference]

Schaffer collateral - CA1 synapse

anchoring junction [inference]

cell-substrate junction [inference]

focal adhesion

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

extracellular vesicle [inference]

extracellular exosome

intracellular membrane-bounded organelle [inference]

nucleus

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying **all 5** entries
GO Term	Evidence Code	Reference
GTPase activity	TAS	PMID
GTPase activity	IEA	GO_REF
GTP binding	TAS	PMID
GTP binding	IEA	GO_REF
GDP binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity [inference]

GTPase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

GDP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

purine ribonucleoside triphosphate binding [inference]

GTP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

purine ribonucleoside triphosphate binding [inference]

GTP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
34	O-linked (GlcNAc) tyrosine; by Photorhabdus PAU_02230	24141704		UniProt GlyGen
37	(Microbial infection) O-linked (Glc) threonine; by C.difficile toxins TcdA and TcdB	24905543		UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 9** entries
Pathway Name	Organism
G alpha (12/13) signalling events	Homo sapiens
GPVI-mediated activation cascade	Homo sapiens
RHO GTPases Activate Formins	Homo sapiens
RHO GTPases Activate ROCKs	Homo sapiens
RHO GTPases Activate Rhotekin and Rhophilins	Homo sapiens
RHO GTPases activate CIT	Homo sapiens
RHO GTPases activate PKNs	Homo sapiens
RHOB GTPase cycle	Homo sapiens
Sema4D induced cell migration and growth-cone collapse	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements