GlyCosmos Portal

Submissions

Ras-related protein Rab-3A

Summary

UniProt ID

P63011

Gene Symbol

Rab3a

Gene ID

[19339]

Organism

Mus musculus (house mouse)

External Links

GlyGen: P63011
PubChem: P63011
The O-GlcNAc Database: P63011
RaftProt: P63011
O-GlcNAcAtlas: P63011
Re-Glyco: P63011

Annotation

Keyword: Cell membrane Cell projection Cytoplasm Cytoplasmic vesicle Direct protein sequencing Exocytosis GTP-binding Hydrolase Lysosome Magnesium Metal-binding Methylation Phosphoprotein Prenylation Protein transport Reference proteome Synapse

Gene Ontology (GO)

Displaying entries **1 - 5** of 49 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane repair	ISO	GO_REF
plasma membrane repair	IEA	GO_REF
respiratory system process	IMP	PMID
exocytosis	ISO	GO_REF
exocytosis	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling [inference]

synaptic signaling [inference]

trans-synaptic signaling [inference]

anterograde trans-synaptic signaling [inference]

chemical synaptic transmission [inference]

neuromuscular synaptic transmission

vesicle-mediated transport [inference]

exocytosis

regulated exocytosis

synaptic vesicle exocytosis

calcium-ion regulated exocytosis

acrosomal vesicle exocytosis

vesicle-mediated transport in synapse [inference]

synaptic vesicle exocytosis

synaptic vesicle transport

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

mitochondrion organization

vesicle organization [inference]

synaptic vesicle maturation

cell projection organization [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis [inference]

axonogenesis

cell junction organization [inference]

cell junction maintenance [inference]

maintenance of synapse structure [inference]

maintenance of presynaptic active zone structure

synapse organization [inference]

maintenance of synapse structure [inference]

maintenance of presynaptic active zone structure

cellular component maintenance [inference]

cell junction maintenance [inference]

maintenance of synapse structure [inference]

maintenance of presynaptic active zone structure

membrane organization [inference]

plasma membrane organization [inference]

plasma membrane repair

presynaptic active zone organization [inference]

maintenance of presynaptic active zone structure

export from cell [inference]

secretion by cell [inference]

exocytosis

regulated exocytosis

synaptic vesicle exocytosis

calcium-ion regulated exocytosis

acrosomal vesicle exocytosis

protein secretion [inference]

insulin secretion

signal release [inference]

hormone secretion [inference]

peptide hormone secretion [inference]

insulin secretion

signal release from synapse [inference]

neurotransmitter secretion [inference]

evoked neurotransmitter secretion

synaptic vesicle exocytosis

multicellular organismal process [inference]

system process [inference]

respiratory system process

nervous system process [inference]

sensory perception [inference]

sensory perception of mechanical stimulus [inference]

sensory perception of touch

post-embryonic development

developmental process [inference]

anatomical structure morphogenesis [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis [inference]

axonogenesis

developmental maturation [inference]

synaptic vesicle maturation

anatomical structure development [inference]

animal organ development [inference]

lung development

response to stimulus [inference]

response to abiotic stimulus [inference]

response to electrical stimulus

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

protein secretion [inference]

insulin secretion

protein localization to extracellular region [inference]

protein secretion [inference]

insulin secretion

establishment of localization [inference]

transport [inference]

neurotransmitter transport [inference]

neurotransmitter secretion [inference]

evoked neurotransmitter secretion

hormone transport [inference]

hormone secretion [inference]

peptide hormone secretion [inference]

insulin secretion

protein transport [inference]

protein secretion [inference]

insulin secretion

peptide transport [inference]

peptide secretion [inference]

peptide hormone secretion [inference]

insulin secretion

vesicle-mediated transport [inference]

exocytosis

regulated exocytosis

synaptic vesicle exocytosis

calcium-ion regulated exocytosis

acrosomal vesicle exocytosis

vesicle-mediated transport in synapse [inference]

synaptic vesicle exocytosis

synaptic vesicle recycling

secretion [inference]

peptide secretion [inference]

peptide hormone secretion [inference]

insulin secretion

secretion by cell [inference]

exocytosis

regulated exocytosis

synaptic vesicle exocytosis

calcium-ion regulated exocytosis

acrosomal vesicle exocytosis

protein secretion [inference]

insulin secretion

signal release [inference]

hormone secretion [inference]

peptide hormone secretion [inference]

insulin secretion

signal release from synapse [inference]

neurotransmitter secretion [inference]

evoked neurotransmitter secretion

synaptic vesicle exocytosis

synaptic vesicle transport

nitrogen compound transport [inference]

peptide hormone secretion [inference]

insulin secretion

export from cell [inference]

secretion by cell [inference]

exocytosis

regulated exocytosis

synaptic vesicle exocytosis

calcium-ion regulated exocytosis

acrosomal vesicle exocytosis

protein secretion [inference]

insulin secretion

signal release [inference]

hormone secretion [inference]

peptide hormone secretion [inference]

insulin secretion

signal release from synapse [inference]

neurotransmitter secretion [inference]

evoked neurotransmitter secretion

synaptic vesicle exocytosis

establishment of protein localization [inference]

protein transport [inference]

protein secretion [inference]

insulin secretion

establishment of protein localization to extracellular region [inference]

protein secretion [inference]

insulin secretion

establishment of localization in cell [inference]

neurotransmitter secretion [inference]

evoked neurotransmitter secretion

establishment of vesicle localization [inference]

synaptic vesicle transport

establishment of organelle localization [inference]

establishment of vesicle localization [inference]

synaptic vesicle transport

organelle localization [inference]

vesicle localization [inference]

establishment of vesicle localization [inference]

synaptic vesicle transport

synaptic vesicle localization [inference]

establishment of organelle localization [inference]

establishment of vesicle localization [inference]

synaptic vesicle transport

vacuolar localization [inference]

lysosome localization

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of synaptic plasticity [inference]

regulation of neuronal synaptic plasticity [inference]

regulation of short-term neuronal synaptic plasticity

regulation of long-term synaptic potentiation

presynaptic modulation of chemical synaptic transmission [inference]

regulation of presynaptic dense core granule exocytosis

signaling [inference]

cell-cell signaling [inference]

synaptic signaling [inference]

trans-synaptic signaling [inference]

anterograde trans-synaptic signaling [inference]

chemical synaptic transmission [inference]

neuromuscular synaptic transmission

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway

regulation of secretion by cell [inference]

regulation of exocytosis

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway

regulation of regulated secretory pathway [inference]

regulation of calcium ion-dependent exocytosis [inference]

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of dense core granule exocytosis [inference]

regulation of presynaptic dense core granule exocytosis

positive regulation of regulated secretory pathway

regulation of synaptic vesicle exocytosis

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of catecholamine secretion [inference]

regulation of dopamine secretion

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway

regulation of neurotransmitter transport [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of amine transport [inference]

regulation of catecholamine secretion [inference]

regulation of dopamine secretion

regulation of vesicle-mediated transport [inference]

regulation of exocytosis

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway

regulation of regulated secretory pathway [inference]

regulation of calcium ion-dependent exocytosis [inference]

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of dense core granule exocytosis [inference]

regulation of presynaptic dense core granule exocytosis

positive regulation of regulated secretory pathway

regulation of synaptic vesicle exocytosis

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of vesicle fusion [inference]

regulation of synaptic vesicle fusion to presynaptic active zone membrane

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of synaptic plasticity [inference]

regulation of neuronal synaptic plasticity [inference]

regulation of short-term neuronal synaptic plasticity

regulation of long-term synaptic potentiation

presynaptic modulation of chemical synaptic transmission [inference]

regulation of presynaptic dense core granule exocytosis

regulation of cellular component biogenesis [inference]

regulation of protein-containing complex assembly [inference]

regulation of synaptic vesicle priming

positive regulation of cellular process [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

regulation of vesicle fusion [inference]

regulation of synaptic vesicle fusion to presynaptic active zone membrane

regulation of protein-containing complex assembly [inference]

regulation of synaptic vesicle priming

regulation of synaptic vesicle membrane organization [inference]

regulation of synaptic vesicle fusion to presynaptic active zone membrane

regulation of plasma membrane organization [inference]

regulation of plasma membrane repair

regulation of vesicle-mediated transport [inference]

regulation of exocytosis

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway

regulation of regulated secretory pathway [inference]

regulation of calcium ion-dependent exocytosis [inference]

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of dense core granule exocytosis [inference]

regulation of presynaptic dense core granule exocytosis

positive regulation of regulated secretory pathway

regulation of synaptic vesicle exocytosis

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of vesicle fusion [inference]

regulation of synaptic vesicle fusion to presynaptic active zone membrane

regulation of secretion by cell [inference]

regulation of exocytosis

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway

regulation of regulated secretory pathway [inference]

regulation of calcium ion-dependent exocytosis [inference]

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of dense core granule exocytosis [inference]

regulation of presynaptic dense core granule exocytosis

positive regulation of regulated secretory pathway

regulation of synaptic vesicle exocytosis

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

regulation of calcium ion-dependent exocytosis of neurotransmitter [inference]

regulation of presynaptic dense core granule exocytosis

regulation of catecholamine secretion [inference]

regulation of dopamine secretion

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone transport [inference]

hormone secretion [inference]

peptide hormone secretion [inference]

insulin secretion

regulation of synaptic plasticity [inference]

regulation of neuronal synaptic plasticity [inference]

regulation of short-term neuronal synaptic plasticity

regulation of long-term synaptic potentiation

Displaying entries **1 - 5** of 33 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
acrosomal vesicle	IDA	PMID
lysosome	ISS	GO_REF
lysosome	ISO	GO_REF
lysosome	IEA	GO_REF
endosome	IDA	PMID

GO Hierarchy

cellular component

protein-containing complex

cellular anatomical structure [inference]

cytosol

membrane [inference]

plasma membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

transport vesicle membrane [inference]

clathrin-sculpted glutamate transport vesicle membrane

exocytic vesicle membrane [inference]

synaptic vesicle membrane

coated vesicle membrane [inference]

clathrin-coated vesicle membrane [inference]

clathrin-sculpted glutamate transport vesicle membrane

bounding membrane of organelle [inference]

transport vesicle membrane [inference]

clathrin-sculpted glutamate transport vesicle membrane

exocytic vesicle membrane [inference]

synaptic vesicle membrane

coated vesicle membrane [inference]

clathrin-coated vesicle membrane [inference]

clathrin-sculpted glutamate transport vesicle membrane

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

axon

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

secretory granule

acrosomal vesicle

exocytic vesicle [inference]

synaptic vesicle

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

secretory granule

acrosomal vesicle

exocytic vesicle [inference]

synaptic vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

secretory granule

acrosomal vesicle

exocytic vesicle [inference]

synaptic vesicle

presynapse

terminal bouton

postsynapse

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
ATPase activator activity	ISO	GO_REF
GTPase activity	ISS	GO_REF
GTPase activity	ISO	GO_REF
GTPase activity	IBA	GO_REF
GTPase activity	IEA	GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity [inference]

GTPase activity

G protein activity

binding [inference]

protein binding [inference]

cytoskeletal protein binding [inference]

myosin binding [inference]

myosin V binding

enzyme binding [inference]

ATPase binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

GTP binding

cation binding [inference]

metal ion binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

molecular adaptor activity [inference]

protein-macromolecule adaptor activity

molecular function regulator activity [inference]

G protein activity

molecular function activator activity [inference]

ATPase activator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	PubMed ID	GlyTouCan ID	Source
30		G62765YT	GlyGen
188	33300544 40885482	G49108TO	The O-GlcNAc Database
199		G49108TO	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 9** entries
Pathway Name	Organism
Acetylcholine Neurotransmitter Release Cycle	Mus musculus
Dopamine Neurotransmitter Release Cycle	Mus musculus
GABA synthesis, release, reuptake and degradation	Mus musculus
Glutamate Neurotransmitter Release Cycle	Mus musculus
Neutrophil degranulation	Mus musculus
Norepinephrine Neurotransmitter Release Cycle	Mus musculus
RAB GEFs exchange GTP for GDP on RABs	Mus musculus
RAB geranylgeranylation	Mus musculus
Serotonin Neurotransmitter Release Cycle	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements