GlyCosmos Portal

Submissions

Prohibitin 1

Summary

UniProt ID

P67779

Gene Symbol

Phb
Phb1

Gene ID

25344

Organism

Rattus norvegicus (Norway rat)

External Links

GlyGen: P67779
PubChem: P67779
The O-GlcNAc Database: P67779
O-GlcNAcAtlas: P67779
Re-Glyco: P67779

Annotation

Keyword: Acetylation Cell membrane Coiled coil Cytoplasm DNA synthesis Direct protein sequencing Mitochondrion inner membrane Nucleus Phosphoprotein Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 57 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II	ISO	GO_REF
ovarian follicle development	IEP	PMID
ovarian follicle atresia	IEP	PMID
positive regulation of immunoglobulin production	ISS	GO_REF
positive regulation of immunoglobulin production	ISO	GO_REF

GO Hierarchy

biological process

immune system process [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

immune response [inference]

adaptive immune response [inference]

adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

T-helper 17 type immune response

innate immune response [inference]

antiviral innate immune response

leukocyte activation [inference]

lymphocyte activation [inference]

B cell activation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

B cell activation

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

hormone-mediated signaling pathway [inference]

steroid hormone receptor signaling pathway [inference]

nuclear receptor-mediated steroid hormone signaling pathway [inference]

progesterone receptor signaling pathway

intracellular signal transduction [inference]

intracellular receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

nuclear receptor-mediated signaling pathway [inference]

nuclear receptor-mediated steroid hormone signaling pathway [inference]

progesterone receptor signaling pathway

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

DNA biosynthetic process

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

DNA biosynthetic process

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

DNA biosynthetic process

nucleic acid metabolic process [inference]

DNA metabolic process [inference]

DNA biosynthetic process

nucleic acid biosynthetic process [inference]

DNA biosynthetic process

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

DNA biosynthetic process

nucleic acid metabolic process [inference]

DNA metabolic process [inference]

DNA biosynthetic process

nucleic acid biosynthetic process [inference]

DNA biosynthetic process

cellular component organization or biogenesis [inference]

cellular component organization [inference]

chromatin organization [inference]

chromatin remodeling [inference]

epigenetic regulation of gene expression

organelle organization [inference]

mitochondrion organization

reproductive process [inference]

developmental process involved in reproduction [inference]

ovarian follicle atresia

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

B cell activation

developmental process [inference]

developmental process involved in reproduction [inference]

ovarian follicle atresia

anatomical structure development [inference]

ovarian follicle development

regeneration [inference]

animal organ regeneration

animal organ development [inference]

animal organ regeneration

biological process involved in interspecies interaction between organisms [inference]

modulation of process of another organism [inference]

host-mediated perturbation of symbiont process [inference]

host-mediated perturbation of viral process [inference]

host-mediated perturbation of viral RNA genome replication

biological process involved in symbiotic interaction [inference]

biological process involved in interaction with host [inference]

symbiont entry into host [inference]

symbiont entry into host cell

response to other organism [inference]

response to virus [inference]

defense response to virus [inference]

antiviral innate immune response

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

antiviral innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to virus [inference]

antiviral innate immune response

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

antiviral innate immune response

response to immobilization stress

immune response [inference]

adaptive immune response [inference]

adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

T-helper 17 type immune response

innate immune response [inference]

antiviral innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus [inference]

defense response to virus [inference]

antiviral innate immune response

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

antiviral innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus [inference]

defense response to virus [inference]

antiviral innate immune response

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

antiviral innate immune response

response to endogenous stimulus [inference]

response to hormone [inference]

response to peptide hormone

response to chemical [inference]

response to xenobiotic stimulus

response to hormone [inference]

response to peptide hormone

response to peptide [inference]

response to cytokine

response to interleukin-6 [inference]

cellular response to interleukin-6

cellular response to cytokine stimulus [inference]

cellular response to interleukin-6

response to nitrogen compound [inference]

response to peptide hormone

response to oxygen-containing compound [inference]

response to peptide hormone

response to alcohol [inference]

response to ethanol

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of complement activation

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of humoral immune response [inference]

positive regulation of complement activation

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of immune effector process [inference]

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of complement activation

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of complement activation [inference]

positive regulation of complement activation

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of humoral immune response [inference]

positive regulation of humoral immune response [inference]

positive regulation of complement activation

regulation of complement activation [inference]

positive regulation of complement activation

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of humoral immune response [inference]

positive regulation of complement activation

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of intracellular signal transduction [inference]

regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

regulation of androgen receptor signaling pathway [inference]

negative regulation of androgen receptor signaling pathway

regulation of nuclear receptor-mediated glucocorticoid signaling pathway [inference]

negative regulation of nuclear receptor-mediated glucocorticoid signaling pathway

regulation of MAPK cascade [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of non-canonical NF-kappaB signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of growth [inference]

regulation of cell growth [inference]

negative regulation of cell growth

negative regulation of growth [inference]

negative regulation of cell growth

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of complement activation

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of humoral immune response [inference]

positive regulation of complement activation

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of smooth muscle cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-17 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-17 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of humoral immune response [inference]

positive regulation of complement activation

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-17 production

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

negative regulation of growth [inference]

negative regulation of cell growth

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

negative regulation of cell growth

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of response to stimulus [inference]

regulation of response to biotic stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of signal transduction [inference]

regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of intracellular signal transduction [inference]

regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

regulation of androgen receptor signaling pathway [inference]

negative regulation of androgen receptor signaling pathway

regulation of nuclear receptor-mediated glucocorticoid signaling pathway [inference]

negative regulation of nuclear receptor-mediated glucocorticoid signaling pathway

regulation of MAPK cascade [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of non-canonical NF-kappaB signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of humoral immune response [inference]

positive regulation of complement activation

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of humoral immune response [inference]

positive regulation of humoral immune response [inference]

positive regulation of complement activation

regulation of complement activation [inference]

positive regulation of complement activation

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of humoral immune response [inference]

positive regulation of complement activation

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of response to stress [inference]

regulation of defense response [inference]

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

hormone-mediated signaling pathway [inference]

steroid hormone receptor signaling pathway [inference]

nuclear receptor-mediated steroid hormone signaling pathway [inference]

progesterone receptor signaling pathway

intracellular signal transduction [inference]

intracellular receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

nuclear receptor-mediated signaling pathway [inference]

nuclear receptor-mediated steroid hormone signaling pathway [inference]

progesterone receptor signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of intracellular signal transduction [inference]

regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

regulation of androgen receptor signaling pathway [inference]

negative regulation of androgen receptor signaling pathway

regulation of nuclear receptor-mediated glucocorticoid signaling pathway [inference]

negative regulation of nuclear receptor-mediated glucocorticoid signaling pathway

regulation of MAPK cascade [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of non-canonical NF-kappaB signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-17 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-17 production

regulation of interleukin-17 production [inference]

positive regulation of interleukin-17 production

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-17 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-17 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-17 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-17 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of catabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-17 production

regulation of interleukin-17 production [inference]

positive regulation of interleukin-17 production

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-17 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-17 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-17 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of protein metabolic process [inference]

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of protein metabolic process [inference]

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of smooth muscle cell proliferation

negative regulation of cell population proliferation

regulation of smooth muscle cell proliferation [inference]

positive regulation of smooth muscle cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

negative regulation of apoptotic process

regulation of neuron apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of smooth muscle cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-17 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of interleukin-17 production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of MAPK cascade [inference]

negative regulation of ERK1 and ERK2 cascade

negative regulation of cell growth

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

regulation of cellular component organization [inference]

regulation of cell growth [inference]

negative regulation of cell growth

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-17 production

regulation of interleukin-17 production [inference]

positive regulation of interleukin-17 production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-17 production

regulation of biological quality [inference]

regulation of protein stability [inference]

protein stabilization

Displaying entries **1 - 5** of 33 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISS	GO_REF
nucleus	ISO	GO_REF
nucleus	IEA	GO_REF GO_REF
nucleoplasm	ISO	GO_REF
cytoplasm	ISS	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

inner mitochondrial membrane protein complex [inference]

mitochondrial prohibitin complex

mitochondrial protein-containing complex [inference]

inner mitochondrial membrane protein complex [inference]

mitochondrial prohibitin complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

outer membrane [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

bounding membrane of organelle [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

extrinsic component of membrane [inference]

extrinsic component of plasma membrane [inference]

extrinsic component of synaptic membrane [inference]

extrinsic component of presynaptic membrane [inference]

extrinsic component of presynaptic active zone membrane

cell junction [inference]

synapse

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

transport vesicle [inference]

exocytic vesicle

secretory vesicle [inference]

exocytic vesicle

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

transport vesicle [inference]

exocytic vesicle

secretory vesicle [inference]

exocytic vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

transport vesicle [inference]

exocytic vesicle

secretory vesicle [inference]

exocytic vesicle

postsynaptic specialization [inference]

postsynaptic density

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
complement component C3a binding	ISO	GO_REF
complement component C3b binding	ISO	GO_REF
transcription corepressor activity	ISO	GO_REF
transcription corepressor activity	IEA	GO_REF
enzyme binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

opsonin binding [inference]

complement component C3b binding

complement binding [inference]

signaling receptor binding [inference]

G protein-coupled receptor binding [inference]

proteinase activated receptor binding

enzyme binding

histone deacetylase binding

protein dimerization activity [inference]

protein heterodimerization activity

transcription regulator activity [inference]

transcription coregulator activity [inference]

transcription corepressor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites