GlyCosmos Portal

Submissions

14-3-3 protein eta

Summary

UniProt ID

P68510

Gene Symbol

Ywhah

Gene ID

[22629]

Organism

Mus musculus (house mouse)

External Links

PubChem: P68510
The O-GlcNAc Database: P68510
RaftProt: P68510
Re-Glyco: P68510

Annotation

Keyword: 3D-structure Acetylation Cytoplasm Direct protein sequencing Phosphoprotein Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 28 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
regulation of sodium ion transport	ISS	PMID
regulation of sodium ion transport	ISO	GO_REF
regulation of sodium ion transport	IEA	GO_REF
glucocorticoid catabolic process	ISS	GO_REF
glucocorticoid catabolic process	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction

hormone-mediated signaling pathway [inference]

steroid hormone receptor signaling pathway [inference]

nuclear receptor-mediated steroid hormone signaling pathway [inference]

nuclear receptor-mediated corticosteroid signaling pathway [inference]

nuclear receptor-mediated glucocorticoid signaling pathway

intracellular signal transduction [inference]

intracellular receptor signaling pathway [inference]

nuclear receptor-mediated signaling pathway [inference]

nuclear receptor-mediated steroid hormone signaling pathway [inference]

nuclear receptor-mediated corticosteroid signaling pathway [inference]

nuclear receptor-mediated glucocorticoid signaling pathway

metabolic process [inference]

catabolic process [inference]

lipid catabolic process [inference]

steroid catabolic process [inference]

glucocorticoid catabolic process

primary metabolic process [inference]

lipid metabolic process [inference]

steroid metabolic process [inference]

steroid catabolic process [inference]

glucocorticoid catabolic process

glucocorticoid metabolic process [inference]

glucocorticoid catabolic process

lipid catabolic process [inference]

steroid catabolic process [inference]

glucocorticoid catabolic process

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization

localization [inference]

macromolecule localization [inference]

intracellular protein localization

protein transport [inference]

intracellular protein transport

establishment of localization [inference]

transport [inference]

protein transport [inference]

intracellular protein transport

intracellular transport [inference]

intracellular protein transport

establishment of protein localization [inference]

protein transport [inference]

intracellular protein transport

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

presynaptic modulation of chemical synaptic transmission

regulation of localization [inference]

regulation of transport [inference]

regulation of monoatomic ion transport [inference]

regulation of metal ion transport [inference]

regulation of sodium ion transport

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of dendrite morphogenesis

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of dendrite morphogenesis

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of dendrite morphogenesis

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of dendrite morphogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of dendrite morphogenesis

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of dendrite morphogenesis [inference]

negative regulation of dendrite morphogenesis

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of dendrite morphogenesis

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of dendrite morphogenesis

regulation of neurogenesis [inference]

negative regulation of neurogenesis [inference]

negative regulation of dendrite morphogenesis

regulation of dendrite development [inference]

regulation of dendrite morphogenesis [inference]

negative regulation of dendrite morphogenesis

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of dendrite morphogenesis

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of dendrite morphogenesis

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

negative regulation of neurogenesis [inference]

negative regulation of dendrite morphogenesis

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of dendrite morphogenesis

regulation of cellular process [inference]

signal transduction

hormone-mediated signaling pathway [inference]

steroid hormone receptor signaling pathway [inference]

nuclear receptor-mediated steroid hormone signaling pathway [inference]

nuclear receptor-mediated corticosteroid signaling pathway [inference]

nuclear receptor-mediated glucocorticoid signaling pathway

intracellular signal transduction [inference]

intracellular receptor signaling pathway [inference]

nuclear receptor-mediated signaling pathway [inference]

nuclear receptor-mediated steroid hormone signaling pathway [inference]

nuclear receptor-mediated corticosteroid signaling pathway [inference]

nuclear receptor-mediated glucocorticoid signaling pathway

regulation of cell communication [inference]

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

presynaptic modulation of chemical synaptic transmission

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of dendrite morphogenesis

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of dendrite morphogenesis

regulation of neurogenesis [inference]

negative regulation of neurogenesis [inference]

negative regulation of dendrite morphogenesis

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of dendrite morphogenesis

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of dendrite morphogenesis

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of dendrite morphogenesis

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

regulation of dendrite development [inference]

regulation of dendrite morphogenesis [inference]

negative regulation of dendrite morphogenesis

regulation of organelle organization [inference]

regulation of nuclear division [inference]

regulation of mitotic nuclear division

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of dendrite morphogenesis

regulation of cell cycle [inference]

regulation of mitotic cell cycle [inference]

regulation of mitotic nuclear division

regulation of cell cycle process [inference]

regulation of mitotic nuclear division

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of dendrite morphogenesis

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

negative regulation of neurogenesis [inference]

negative regulation of dendrite morphogenesis

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of dendrite morphogenesis

regulation of biological quality [inference]

regulation of membrane potential [inference]

membrane depolarization [inference]

membrane depolarization during action potential

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	NAS	PMID
cytoplasm	IDA	PMID
cytoplasm	IEA	GO_REF
mitochondrion	ISO	GO_REF
mitochondrion	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

cell junction [inference]

synapse

excitatory synapse [inference]

asymmetric, glutamatergic, excitatory synapse [inference]

cerebellar granule cell to Purkinje cell synapse

glutamatergic synapse

asymmetric, glutamatergic, excitatory synapse [inference]

cerebellar granule cell to Purkinje cell synapse

neuron to neuron synapse [inference]

asymmetric synapse [inference]

asymmetric, glutamatergic, excitatory synapse [inference]

cerebellar granule cell to Purkinje cell synapse

anchoring junction [inference]

cell-cell junction [inference]

cell-cell contact zone [inference]

intercalated disc

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

presynapse

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
actin binding	IDA	PMID
sodium channel regulator activity	ISS	PMID
sodium channel regulator activity	ISO	GO_REF
sodium channel regulator activity	IEA	GO_REF
enzyme binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

cytoskeletal protein binding [inference]

actin binding

transcription factor binding [inference]

DNA-binding transcription factor binding [inference]

RNA polymerase II-specific DNA-binding transcription factor binding [inference]

nuclear receptor binding [inference]

nuclear glucocorticoid receptor binding

protein dimerization activity [inference]

protein heterodimerization activity

molecular function regulator activity [inference]

transporter regulator activity [inference]

channel regulator activity [inference]

ion channel regulator activity [inference]

sodium channel regulator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
70		36610251 37453647 37507081 39627609	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Activation of BAD and translocation to mitochondria	Mus musculus
Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex	Mus musculus
RHO GTPases activate PKNs	Mus musculus
TP53 Regulates Metabolic Genes	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements