GlyCosmos Portal

Submissions

Sushi repeat-containing protein SRPX

Summary

UniProt ID: P78539
Gene Symbol: SRPX ETX1
Gene ID: 8406
Organism: Homo sapiens (human)

External Links

GlyGen: P78539
Re-Glyco: P78539

Annotation

Keyword: Alternative splicing Cell adhesion Disulfide bond Proteoglycan Proteomics identification Reference proteome Repeat Signal Sushi

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
phagolysosome assembly	IBA	GO_REF
autophagy
cell adhesion
response to endoplasmic reticulum stress
negative regulation of cell proliferation involved in contact inhibition

GO Hierarchy

biological process

cellular process [inference]

cell adhesion

metabolic process [inference]

catabolic process [inference]

autophagy

cellular response to stimulus [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress

process utilizing autophagic mechanism [inference]

autophagy

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

vacuole organization [inference]

lytic vacuole organization [inference]

lysosome organization [inference]

phagolysosome assembly

vesicle organization [inference]

phagolysosome assembly

organelle assembly [inference]

phagolysosome assembly

cellular component assembly [inference]

organelle assembly [inference]

phagolysosome assembly

response to stimulus [inference]

response to stress [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress

cellular response to stimulus [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of cell proliferation involved in contact inhibition

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of cell proliferation involved in contact inhibition

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of cell proliferation involved in contact inhibition

Displaying **all 5** entries
GO Term	Evidence Code	Reference
autophagosome
endoplasmic reticulum
cell surface	IEA	GO_REF
membrane	TAS	PMID
extracellular matrix	HDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

external encapsulating structure [inference]

extracellular matrix

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

autophagosome

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

autophagosome

endoplasmic reticulum

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGSPAHRPALLLLLPPLLLLLLLRVPPSRSFPGSGDSPLEDDEVGYSHPRYKDTPWCSPIKVKYGDVYCRAPQGGYYKTALGTRCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRCPTLAMPANGGFKCVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPPRIKCPSVKERIAEPNKLTVRVSWETPEGRDTADGILTDVILKGLPPGSNFPEGDHKIQYTVYDRAENKGTCKFRVKVRVKRCGKLNAPENGYMKCSSDGDNYGATCEFSCIGGYELQGSPARVCQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTARNLLYRLQLGMLQQAQCGLDLRHITVVELVGVFPTLIGRIGAKIMPPALALQLRLLLRIPLYSFSMVLVDKHGMDKERYVSLVMPVALFNLIDTFPLRKEEMVLQAEMSQTCNT

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
34	O-linked (Xyl...) (chondroitin sulfate) serine	32337544 36213313		UniProt GlyGen
201		23584533	G57321FI	GlyGen
237		23584533	G57321FI	GlyGen
240		23584533	G57321FI	GlyGen
328		23584533	G57321FI	GlyGen