GlyCosmos Portal

Submissions

Low affinity immunoglobulin gamma Fc region receptor III-A

Summary

UniProt ID

P79107

Gene Symbol

FCGR3
FCGR3A
FCGRIII

Gene ID

[281766]

Organism

Bos taurus (domestic cattle)

External Links

PubChem: P79107
Re-Glyco: P79107

Annotation

Keyword: Cell membrane Disulfide bond Glycoprotein IgG-binding protein Immunoglobulin domain Receptor Reference proteome Repeat Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
antibody-dependent cellular cytotoxicity	IBA	GO_REF
T cell mediated cytotoxicity
dendritic cell antigen processing and presentation	IEA	GO_REF
cell surface receptor signaling pathway	IBA	GO_REF
protein import

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

leukocyte mediated immunity [inference]

leukocyte mediated cytotoxicity [inference]

myeloid leukocyte mediated immunity [inference]

type II hypersensitivity [inference]

type IIa hypersensitivity [inference]

antibody-dependent cellular cytotoxicity

lymphocyte mediated immunity [inference]

T cell mediated immunity [inference]

T cell mediated cytotoxicity

B cell mediated immunity [inference]

immunoglobulin mediated immune response [inference]

type II hypersensitivity [inference]

type IIa hypersensitivity [inference]

antibody-dependent cellular cytotoxicity

immune response [inference]

adaptive immune response [inference]

adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

T cell mediated immunity [inference]

T cell mediated cytotoxicity

B cell mediated immunity [inference]

immunoglobulin mediated immune response [inference]

type II hypersensitivity [inference]

type IIa hypersensitivity [inference]

antibody-dependent cellular cytotoxicity

inflammatory response to antigenic stimulus [inference]

acute inflammatory response to antigenic stimulus [inference]

hypersensitivity [inference]

type II hypersensitivity [inference]

type IIa hypersensitivity [inference]

antibody-dependent cellular cytotoxicity

antigen processing and presentation [inference]

dendritic cell antigen processing and presentation

leukocyte activation [inference]

myeloid leukocyte activation [inference]

granulocyte activation [inference]

neutrophil activation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

myeloid leukocyte activation [inference]

granulocyte activation [inference]

neutrophil activation

cell killing [inference]

leukocyte mediated cytotoxicity [inference]

signal transduction [inference]

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

Fc receptor-mediated immune complex endocytosis

transmembrane transport [inference]

protein transmembrane transport

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

myeloid leukocyte activation [inference]

granulocyte activation [inference]

neutrophil activation

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response [inference]

inflammatory response to antigenic stimulus [inference]

acute inflammatory response to antigenic stimulus [inference]

hypersensitivity [inference]

type II hypersensitivity [inference]

type IIa hypersensitivity [inference]

antibody-dependent cellular cytotoxicity

acute inflammatory response [inference]

acute inflammatory response to antigenic stimulus [inference]

hypersensitivity [inference]

type II hypersensitivity [inference]

type IIa hypersensitivity [inference]

antibody-dependent cellular cytotoxicity

immune response [inference]

adaptive immune response [inference]

adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

T cell mediated immunity [inference]

T cell mediated cytotoxicity

B cell mediated immunity [inference]

immunoglobulin mediated immune response [inference]

type II hypersensitivity [inference]

type IIa hypersensitivity [inference]

antibody-dependent cellular cytotoxicity

inflammatory response to antigenic stimulus [inference]

acute inflammatory response to antigenic stimulus [inference]

hypersensitivity [inference]

type II hypersensitivity [inference]

type IIa hypersensitivity [inference]

antibody-dependent cellular cytotoxicity

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

establishment of localization [inference]

transport [inference]

protein transport [inference]

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

Fc receptor-mediated immune complex endocytosis

transmembrane transport [inference]

protein transmembrane transport

import into cell [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

Fc receptor-mediated immune complex endocytosis

establishment of protein localization [inference]

protein transport [inference]

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of bone resorption

regulation of cellular process [inference]

signal transduction [inference]

regulation of multicellular organismal process [inference]

regulation of tissue remodeling [inference]

regulation of bone remodeling [inference]

regulation of bone resorption [inference]

positive regulation of bone resorption

positive regulation of multicellular organismal process [inference]

positive regulation of bone resorption

Displaying 1 entry
GO Term	Evidence Code	Reference
external side of plasma membrane	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

side of membrane [inference]

external side of plasma membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
IgE receptor activity	IEA	GO_REF
IgG receptor activity	IBA	GO_REF
IgG receptor activity	IEA	GO_REF
IgG binding

GO Hierarchy

molecular function

binding [inference]

protein-containing complex binding [inference]

immunoglobulin binding [inference]

IgG binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

immunoglobulin receptor activity [inference]

immune receptor activity [inference]

immunoglobulin receptor activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MWQLLPPAALLLLVSADTQTADPSKAVVLLDPQWNHVLTNDRVTLKCQGDYPVEDNSTKWWHNGTLISSQTPSYFIADVKVQDSGEYKCQTGLSAPSDPVKLEVHVGWLLLQVAQRVVNVGKPIRLKCHSWKKTPVAKVQYFRNGRGKKYSHGNSDFHIPEAKLEHSGSYFCRGIIGSKNESSESVQITVQAPETLQTVSSFFLPWHQITFCLVMGVLFAVDTGLYFSVRRHLQSSEEWRDGKVTWSKGP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
56	N-linked (GlcNAc...) asparagine	UniProt
63	N-linked (GlcNAc...) asparagine	UniProt
180	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Neutrophil degranulation	Bos taurus
Post-translational modification: synthesis of GPI-anchored proteins	Bos taurus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements