GlyCosmos Portal

Submissions

Type-1 angiotensin II receptor

Summary

UniProt ID: P79785
Gene Symbol: AGTR1
Gene ID: 396065
Organism: Gallus gallus (chicken)

External Links

PubChem: P79785
Re-Glyco: P79785

Annotation

Keyword: Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
kidney development	IBA	GO_REF
kidney development	IEA	GO_REF
maintenance of blood vessel diameter homeostasis by renin-angiotensin	ISS	GO_REF
maintenance of blood vessel diameter homeostasis by renin-angiotensin	IEA	GO_REF
inflammatory response	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction [inference]

Rho protein signal transduction

calcium-mediated signaling

cell motility [inference]

cell migration [inference]

cell chemotaxis

multicellular organismal process [inference]

system process [inference]

circulatory system process [inference]

vascular process in circulatory system [inference]

blood vessel diameter maintenance [inference]

endocrine process [inference]

regulation of systemic arterial blood pressure by hormone [inference]

regulation of systemic arterial blood pressure by renin-angiotensin [inference]

maintenance of blood vessel diameter homeostasis by renin-angiotensin

developmental process [inference]

anatomical structure development [inference]

animal organ development [inference]

kidney development

locomotion [inference]

taxis [inference]

chemotaxis [inference]

cell chemotaxis

biological process involved in interspecies interaction between organisms [inference]

biological process involved in symbiotic interaction [inference]

biological process involved in interaction with host [inference]

symbiont entry into host [inference]

symbiont entry into host cell

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of epithelial cell proliferation [inference]

positive regulation of endothelial cell proliferation [inference]

positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis

positive regulation of metabolic process [inference]

positive regulation of lipid metabolic process [inference]

positive regulation of steroid metabolic process [inference]

positive regulation of cholesterol metabolic process

positive regulation of small molecule metabolic process [inference]

positive regulation of cholesterol metabolic process

positive regulation of cell differentiation [inference]

positive regulation of macrophage derived foam cell differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of macrophage derived foam cell differentiation

regulation of developmental process [inference]

regulation of cell differentiation [inference]

regulation of macrophage derived foam cell differentiation [inference]

positive regulation of macrophage derived foam cell differentiation

positive regulation of cell differentiation [inference]

positive regulation of macrophage derived foam cell differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of macrophage derived foam cell differentiation

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction [inference]

Rho protein signal transduction

calcium-mediated signaling

regulation of metabolic process [inference]

positive regulation of metabolic process [inference]

positive regulation of lipid metabolic process [inference]

positive regulation of steroid metabolic process [inference]

positive regulation of cholesterol metabolic process

positive regulation of small molecule metabolic process [inference]

positive regulation of cholesterol metabolic process

regulation of small molecule metabolic process [inference]

positive regulation of small molecule metabolic process [inference]

positive regulation of cholesterol metabolic process

regulation of cholesterol metabolic process [inference]

positive regulation of cholesterol metabolic process

regulation of primary metabolic process [inference]

regulation of lipid metabolic process [inference]

regulation of steroid metabolic process [inference]

positive regulation of steroid metabolic process [inference]

positive regulation of cholesterol metabolic process

regulation of cholesterol metabolic process [inference]

positive regulation of cholesterol metabolic process

positive regulation of lipid metabolic process [inference]

positive regulation of steroid metabolic process [inference]

positive regulation of cholesterol metabolic process

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of epithelial cell proliferation [inference]

positive regulation of endothelial cell proliferation [inference]

positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis

regulation of epithelial cell proliferation [inference]

regulation of endothelial cell proliferation [inference]

positive regulation of endothelial cell proliferation [inference]

positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis

regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis [inference]

positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis

positive regulation of epithelial cell proliferation [inference]

positive regulation of endothelial cell proliferation [inference]

positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis

regulation of cell differentiation [inference]

regulation of macrophage derived foam cell differentiation [inference]

positive regulation of macrophage derived foam cell differentiation

positive regulation of cell differentiation [inference]

positive regulation of macrophage derived foam cell differentiation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of epithelial cell proliferation [inference]

positive regulation of endothelial cell proliferation [inference]

positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis

positive regulation of metabolic process [inference]

positive regulation of lipid metabolic process [inference]

positive regulation of steroid metabolic process [inference]

positive regulation of cholesterol metabolic process

positive regulation of small molecule metabolic process [inference]

positive regulation of cholesterol metabolic process

positive regulation of cell differentiation [inference]

positive regulation of macrophage derived foam cell differentiation

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of blood circulation [inference]

regulation of vasoconstriction

regulation of biological quality [inference]

positive regulation of cytosolic calcium ion concentration

regulation of blood pressure [inference]

regulation of systemic arterial blood pressure [inference]

regulation of systemic arterial blood pressure mediated by a chemical signal [inference]

regulation of systemic arterial blood pressure by hormone [inference]

regulation of systemic arterial blood pressure by renin-angiotensin [inference]

maintenance of blood vessel diameter homeostasis by renin-angiotensin

regulation of anatomical structure size [inference]

regulation of tube size [inference]

regulation of tube diameter [inference]

blood vessel diameter maintenance [inference]

Displaying **all 3** entries
GO Term	Evidence Code	Reference
plasma membrane	ISS	GO_REF
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
angiotensin type I receptor activity	ISS	GO_REF
angiotensin type I receptor activity	IBA	GO_REF
angiotensin type I receptor activity	IEA	GO_REF
angiotensin type II receptor activity	IEA	GO_REF GO_REF
bradykinin receptor binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

G protein-coupled receptor binding [inference]

bradykinin receptor binding

protein dimerization activity [inference]

protein heterodimerization activity

molecular transducer activity [inference]

signaling receptor activity [inference]

peptide receptor activity [inference]

G protein-coupled peptide receptor activity [inference]

angiotensin receptor activity [inference]

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity [inference]

G protein-coupled peptide receptor activity [inference]

angiotensin receptor activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVPNYSTEETVKRIHVDCPVSGRHSYIYIMVPTVYSIIFIIGIFGNSLVVIVIYCYMKLKTVASIFLLNLALADLCFLITLPLWAAYTAMEYQWPFGNCLCKLASAGISFNLYASVFLLTCLSIDRYLAIVHPVKSRIRRTMFVARVTCIVIWLLAGVASLPVIIHRNIFFAENLNMTVCGFRYDNNNTTLRVGLGLSKNLLGFLIPFLIILTSYTLIWKTLKKAYQIQRNKTRNDDIFKMIVAIVFFFFFSWIPHQVFTFLDVLIQLHVITDCKITDIVDTAMPFTICIAYFNNCLNPFFYVFFGKNFKKYFLQLIKYIPPNVSTHPSLTTKMSSLSYRPPENIRLPTKKTAGSFDAE

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
4	N-linked (GlcNAc...) asparagine	UniProt
176	N-linked (GlcNAc...) asparagine	UniProt
187	N-linked (GlcNAc...) asparagine	UniProt
188	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Cargo recognition for clathrin-mediated endocytosis	Gallus gallus
Clathrin-mediated endocytosis	Gallus gallus
G alpha (q) signalling events	Gallus gallus
Peptide ligand-binding receptors	Gallus gallus