GlyCosmos Portal

Submissions

G-protein coupled receptor Mth

Summary

UniProt ID: P83120
Gene Symbol: GD25710 mth
Gene ID
Organism: Drosophila simulans

External Links

Re-Glyco: P83120

Annotation

Keyword: Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Reference proteome Signal Transmembrane helix

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
cell surface receptor signaling pathway	IEA	GO_REF
determination of adult lifespan	IMP	PMID
determination of adult lifespan	IEA	GO_REF
response to starvation	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway

multicellular organismal process [inference]

determination of adult lifespan

response to stimulus [inference]

response to stress [inference]

response to starvation

response to nutrient levels [inference]

response to starvation

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway

Displaying 1 entry
GO Term	Evidence Code	Reference
plasma membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

Displaying 1 entry
GO Term	Evidence Code	Reference
G protein-coupled peptide receptor activity	IEA	GO_REF

GO Hierarchy

molecular function

molecular transducer activity [inference]

signaling receptor activity [inference]

peptide receptor activity [inference]

G protein-coupled peptide receptor activity

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity [inference]

G protein-coupled peptide receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKTLFVLRISTVILVVLVIQKSYADILECDYFDTVDISAAQKLQNGSYLFEGLLVPAILTGEYDFRILPDDSKQKVASHIRGCVCKLKPCVRFCCPHDHIMDNGVCNDNMSEEELTELDPFLNVTLDDGSVSRRHFKNELIVQWDLPMPCDGMFYLDNREEQDQYTLFENGTFFRHFDRVTLSKREYCLQHLTFADGNATSIRIAPHNCLIVPSITGQTVVMITSLICMVLTIAVYLFVKKLQNLHGKCFICYMVCLFMGYLFLLFDLWQISISFCKPAGVLGYFFVMAAFLWLSVISLHLWNTFRGSSHKASRFFSEHRFLAYNTYAWGMSMVLTGITVLADNVVEDQDWNPRVGEEGHCWIYTQAWSAMLYFYGPMVFLIAFNITMFILTARRIIGVKKDIQNFAHRQERKQKLNSDKQTYTFFLRLFIIMGLSWSLEIGSYISQSNQTWANVFLVADYLNWSQGIIIFILFILKRSTLRLLQESIRGEGEEVDNSEEEISLENTRFDRNVLS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	Source
45	N-linked (GlcNAc...) asparagine	UniProt
109	N-linked (GlcNAc...) asparagine	UniProt
123	N-linked (GlcNAc...) asparagine	UniProt
170	N-linked (GlcNAc...) asparagine	UniProt
198	N-linked (GlcNAc...) asparagine	UniProt
449	N-linked (GlcNAc...) asparagine	UniProt