GlyCosmos Portal

Submissions

Growth/differentiation factor 6-A

Summary

UniProt ID: P85857
Gene Symbol: gdf6a radar rdr
Gene ID: 566470
Organism: Danio rerio (zebrafish)

External Links

Re-Glyco: P85857

Annotation

Keyword: Apoptosis Cleavage on pair of basic residues Developmental protein Disulfide bond Glycoprotein Growth factor Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 28 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
retina homeostasis	IMP	PMID
blood vessel maturation	IMP	PMID
apoptotic process	IDA	PMID
dorsal/ventral pattern formation	IMP	PMID PMID
BMP signaling pathway	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

BMP signaling pathway

cell death [inference]

programmed cell death [inference]

apoptotic process

retinal cell apoptotic process

cellular developmental process [inference]

cell fate determination [inference]

neuron fate determination [inference]

photoreceptor cell fate determination [inference]

retinal cone cell fate determination

cell differentiation [inference]

neuron differentiation [inference]

photoreceptor cell differentiation [inference]

eye photoreceptor cell differentiation [inference]

camera-type eye photoreceptor cell differentiation

retinal cone cell differentiation

cell fate commitment [inference]

neuron fate commitment [inference]

photoreceptor cell fate commitment

cell development [inference]

neuron development [inference]

photoreceptor cell development [inference]

eye photoreceptor cell development

muscle cell development [inference]

striated muscle cell development [inference]

myotube cell development [inference]

skeletal muscle fiber development

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

neuron projection guidance [inference]

axon guidance [inference]

retinal ganglion cell axon guidance

multicellular organismal process [inference]

pattern specification process [inference]

regionalization [inference]

dorsal/ventral pattern formation

determination of ventral identity

multicellular organismal-level homeostasis [inference]

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

retina homeostasis

developmental process [inference]

anatomical structure morphogenesis [inference]

tube morphogenesis [inference]

blood vessel morphogenesis

embryonic morphogenesis [inference]

embryonic retina morphogenesis in camera-type eye

developmental maturation [inference]

anatomical structure maturation [inference]

blood vessel maturation

anatomical structure development [inference]

cell development [inference]

neuron development [inference]

photoreceptor cell development [inference]

eye photoreceptor cell development

muscle cell development [inference]

striated muscle cell development [inference]

myotube cell development [inference]

skeletal muscle fiber development

animal organ development [inference]

sensory organ development [inference]

eye development [inference]

camera-type eye development

embryonic camera-type eye development

embryonic organ development [inference]

embryonic camera-type eye development

system development [inference]

skeletal system development [inference]

embryonic skeletal system development

vasculature development [inference]

retina vasculature development in camera-type eye

retina development in camera-type eye

cellular developmental process [inference]

cell fate determination [inference]

neuron fate determination [inference]

photoreceptor cell fate determination [inference]

retinal cone cell fate determination

cell differentiation [inference]

neuron differentiation [inference]

photoreceptor cell differentiation [inference]

eye photoreceptor cell differentiation [inference]

camera-type eye photoreceptor cell differentiation

retinal cone cell differentiation

cell fate commitment [inference]

neuron fate commitment [inference]

photoreceptor cell fate commitment

cell development [inference]

neuron development [inference]

photoreceptor cell development [inference]

eye photoreceptor cell development

muscle cell development [inference]

striated muscle cell development [inference]

myotube cell development [inference]

skeletal muscle fiber development

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

retina homeostasis

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of BMP signaling pathway

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of BMP signaling pathway

positive regulation of BMP signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of BMP signaling pathway

regulation of vascular endothelial growth factor signaling pathway [inference]

negative regulation of vascular endothelial growth factor signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of BMP signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of BMP signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of BMP signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of BMP signaling pathway

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

negative regulation of developmental pigmentation [inference]

negative regulation of pigment cell differentiation [inference]

negative regulation of melanocyte differentiation

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

negative regulation of cell differentiation [inference]

negative regulation of pigment cell differentiation [inference]

negative regulation of melanocyte differentiation

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of cellular response to vascular endothelial growth factor stimulus [inference]

negative regulation of vascular endothelial growth factor signaling pathway

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of pigment cell differentiation [inference]

negative regulation of melanocyte differentiation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of BMP signaling pathway

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of BMP signaling pathway

positive regulation of BMP signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of BMP signaling pathway

regulation of vascular endothelial growth factor signaling pathway [inference]

negative regulation of vascular endothelial growth factor signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of BMP signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of cellular response to vascular endothelial growth factor stimulus [inference]

negative regulation of vascular endothelial growth factor signaling pathway

regulation of cellular response to growth factor stimulus [inference]

regulation of BMP signaling pathway

positive regulation of BMP signaling pathway

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of cellular response to vascular endothelial growth factor stimulus [inference]

negative regulation of vascular endothelial growth factor signaling pathway

regulation of cellular response to vascular endothelial growth factor stimulus [inference]

regulation of vascular endothelial growth factor signaling pathway [inference]

negative regulation of vascular endothelial growth factor signaling pathway

negative regulation of cellular response to vascular endothelial growth factor stimulus [inference]

negative regulation of vascular endothelial growth factor signaling pathway

regulation of developmental process [inference]

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of pigment cell differentiation [inference]

negative regulation of melanocyte differentiation

regulation of pigment cell differentiation [inference]

regulation of melanocyte differentiation [inference]

negative regulation of melanocyte differentiation

negative regulation of pigment cell differentiation [inference]

negative regulation of melanocyte differentiation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of pigment cell differentiation [inference]

negative regulation of melanocyte differentiation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

BMP signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of BMP signaling pathway

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of BMP signaling pathway

positive regulation of BMP signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of BMP signaling pathway

regulation of vascular endothelial growth factor signaling pathway [inference]

negative regulation of vascular endothelial growth factor signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of BMP signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

regulation of cell population proliferation

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of pigment cell differentiation [inference]

negative regulation of melanocyte differentiation

regulation of pigment cell differentiation [inference]

regulation of melanocyte differentiation [inference]

negative regulation of melanocyte differentiation

negative regulation of pigment cell differentiation [inference]

negative regulation of melanocyte differentiation

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of BMP signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of vascular endothelial growth factor signaling pathway

negative regulation of cell differentiation [inference]

negative regulation of pigment cell differentiation [inference]

negative regulation of melanocyte differentiation

regulation of pigmentation [inference]

regulation of developmental pigmentation [inference]

negative regulation of developmental pigmentation [inference]

negative regulation of pigment cell differentiation [inference]

negative regulation of melanocyte differentiation

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying **all 2** entries
GO Term	Evidence Code	Reference
cytokine activity	IBA	GO_REF
growth factor activity	IEA	GO_REF

GO Hierarchy

molecular function

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDALRAVAFYALFVFLWSLPCCQSAALISQKRSKGARSAFDGQRSHKFLKEILASSPGASRRDDFKDPVVPHDYMISIYRTYSAAEKLGLNASFFRSSKSANTITSFVDKGKDDLTLSPLRRQTYLFDVSTLSDKEELVGAELRIFRKSPGDVQPSPSGVYNLHLLSCRSERPLASRSIDLQDSRKAEWEVLDVWGIFKHRHQENQLCLQLKVTYGKSDTEIDLKQLGFHRHSRTQQERAILVVYTRSKKRENLFNEMKEKIKSRGDDDEEESALQFKARRRRRTALNNRHGKRHGKKSKSRCSKKALHVNFKELGWDDWIIAPLDYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPNSTPPSCCVPTKLSPISILYIDSGNNVVYKQYEDMVVEQCGCR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
91	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:10629	microphthalmia	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements