GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

ATP synthase peripheral stalk subunit F6, mitochondrial

Summary

UniProt ID: P97450
Gene Symbol: Atp5pf Atp5j
Gene ID: 11957
Organism: Mus musculus (house mouse)

External Links

GlyGen: P97450
PubChem: P97450
O-GlcNAcAtlas: P97450
Re-Glyco: P97450

Annotation

Keyword: Acetylation CF(0) Mitochondrion inner membrane Phosphoprotein Reference proteome Transit peptide

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of heart rate	ISO	GO_REF
negative regulation of prostaglandin secretion	ISO	GO_REF
proton motive force-driven mitochondrial ATP synthesis	ISO	GO_REF
positive regulation of blood pressure	ISO	GO_REF
negative regulation of arachidonate secretion	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

biosynthetic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

small molecule metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine-containing compound metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

carbohydrate derivative metabolic process [inference]

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis [inference]

proton motive force-driven mitochondrial ATP synthesis

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

regulation of lipid transport [inference]

negative regulation of lipid transport [inference]

negative regulation of fatty acid transport [inference]

negative regulation of icosanoid secretion [inference]

regulation of fatty acid transport [inference]

regulation of icosanoid secretion [inference]

negative regulation of icosanoid secretion [inference]

regulation of prostaglandin secretion [inference]

negative regulation of prostaglandin secretion

regulation of arachidonate secretion [inference]

negative regulation of arachidonic acid secretion

negative regulation of fatty acid transport [inference]

negative regulation of icosanoid secretion [inference]

regulation of organic acid transport [inference]

negative regulation of organic acid transport [inference]

negative regulation of fatty acid transport [inference]

negative regulation of icosanoid secretion [inference]

regulation of fatty acid transport [inference]

regulation of icosanoid secretion [inference]

negative regulation of icosanoid secretion [inference]

regulation of prostaglandin secretion [inference]

negative regulation of prostaglandin secretion

regulation of arachidonate secretion [inference]

negative regulation of arachidonic acid secretion

negative regulation of fatty acid transport [inference]

negative regulation of icosanoid secretion [inference]

regulation of secretion [inference]

regulation of icosanoid secretion [inference]

negative regulation of icosanoid secretion [inference]

regulation of prostaglandin secretion [inference]

negative regulation of prostaglandin secretion

regulation of arachidonate secretion [inference]

negative regulation of arachidonic acid secretion

negative regulation of secretion [inference]

negative regulation of icosanoid secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of prostaglandin secretion

regulation of secretion by cell [inference]

regulation of prostaglandin secretion [inference]

negative regulation of prostaglandin secretion

negative regulation of secretion by cell [inference]

negative regulation of prostaglandin secretion

negative regulation of transport [inference]

negative regulation of lipid transport [inference]

negative regulation of fatty acid transport [inference]

negative regulation of icosanoid secretion [inference]

negative regulation of organic acid transport [inference]

negative regulation of fatty acid transport [inference]

negative regulation of icosanoid secretion [inference]

negative regulation of secretion [inference]

negative regulation of icosanoid secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of prostaglandin secretion

regulation of lipid localization [inference]

regulation of lipid transport [inference]

negative regulation of lipid transport [inference]

negative regulation of fatty acid transport [inference]

negative regulation of icosanoid secretion [inference]

regulation of fatty acid transport [inference]

regulation of icosanoid secretion [inference]

negative regulation of icosanoid secretion [inference]

regulation of prostaglandin secretion [inference]

negative regulation of prostaglandin secretion

regulation of arachidonate secretion [inference]

negative regulation of arachidonic acid secretion

negative regulation of fatty acid transport [inference]

negative regulation of icosanoid secretion [inference]

negative regulation of lipid localization [inference]

negative regulation of lipid transport [inference]

negative regulation of fatty acid transport [inference]

negative regulation of icosanoid secretion [inference]

positive regulation of biological process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of blood circulation [inference]

positive regulation of heart contraction [inference]

positive regulation of heart rate

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of secretion by cell [inference]

negative regulation of prostaglandin secretion

negative regulation of transport [inference]

negative regulation of lipid transport [inference]

negative regulation of fatty acid transport [inference]

negative regulation of icosanoid secretion [inference]

negative regulation of organic acid transport [inference]

negative regulation of fatty acid transport [inference]

negative regulation of icosanoid secretion [inference]

negative regulation of secretion [inference]

negative regulation of icosanoid secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of prostaglandin secretion

negative regulation of lipid localization [inference]

negative regulation of lipid transport [inference]

negative regulation of fatty acid transport [inference]

negative regulation of icosanoid secretion [inference]

regulation of cellular process [inference]

negative regulation of cellular process [inference]

negative regulation of secretion by cell [inference]

negative regulation of prostaglandin secretion

regulation of secretion by cell [inference]

regulation of prostaglandin secretion [inference]

negative regulation of prostaglandin secretion

negative regulation of secretion by cell [inference]

negative regulation of prostaglandin secretion

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of blood circulation [inference]

regulation of heart contraction [inference]

regulation of heart rate [inference]

positive regulation of heart rate

positive regulation of heart contraction [inference]

positive regulation of heart rate

positive regulation of blood circulation [inference]

positive regulation of heart contraction [inference]

positive regulation of heart rate

positive regulation of multicellular organismal process [inference]

positive regulation of blood circulation [inference]

positive regulation of heart contraction [inference]

positive regulation of heart rate

regulation of biological quality [inference]

regulation of heart rate [inference]

positive regulation of heart rate

regulation of blood pressure [inference]

positive regulation of blood pressure

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
mitochondrion	ISO	GO_REF
mitochondrion	IEA	GO_REF
mitochondrion	HDA	PMID PMID
mitochondrial inner membrane	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

proton-transporting two-sector ATPase complex [inference]

proton-transporting ATP synthase complex

transmembrane transporter complex [inference]

monoatomic ion channel complex [inference]

cation channel complex [inference]

proton-transporting ATP synthase complex

respiratory chain complex [inference]

proton-transporting ATP synthase complex

catalytic complex [inference]

proton-transporting ATP synthase complex

transporter complex [inference]

transmembrane transporter complex [inference]

monoatomic ion channel complex [inference]

cation channel complex [inference]

proton-transporting ATP synthase complex

cellular anatomical structure [inference]

cell surface

membrane [inference]

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

mitochondrial inner membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

Displaying **all 2** entries
GO Term	Evidence Code	Reference
protein-containing complex binding	ISO	GO_REF
proton-transporting ATP synthase activity, rotational mechanism	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

ligase activity [inference]

proton-transporting ATP synthase activity, rotational mechanism

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic ion channel activity [inference]

monoatomic cation channel activity [inference]

proton channel activity [inference]

proton-transporting ATP synthase activity, rotational mechanism

monoatomic cation transmembrane transporter activity [inference]

monoatomic cation channel activity [inference]

proton channel activity [inference]

proton-transporting ATP synthase activity, rotational mechanism

proton transmembrane transporter activity [inference]

proton channel activity [inference]

proton-transporting ATP synthase activity, rotational mechanism

passive transmembrane transporter activity [inference]

channel activity [inference]

monoatomic ion channel activity [inference]

monoatomic cation channel activity [inference]

proton channel activity [inference]

proton-transporting ATP synthase activity, rotational mechanism

binding [inference]

protein-containing complex binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVLQRIFRLSSVLRSAVSVHLKRNIGVTAVAFNKELDPVQKLFVDKIREYKSKRQASGGPVDIGPEYQQDLDRELYKLKQMYGKGEMDTFPTFKFDDPKFEVIDKPQS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
89			G49108TO	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Cristae formation	Mus musculus
Formation of ATP by chemiosmotic coupling	Mus musculus
Mitochondrial protein degradation	Mus musculus

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026