GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Mitochondrial 2-oxoglutarate/malate carrier protein

Summary

UniProt ID: P97700
Gene Symbol: Slc25a11 Slc20a4
Gene ID: 64201
Organism: Rattus norvegicus (Norway rat)

External Links

GlyGen: P97700
PubChem: P97700
The O-GlcNAc Database: P97700
O-GlcNAcAtlas: P97700
Re-Glyco: P97700

Annotation

Keyword: Acetylation Antiport Mitochondrion inner membrane Phosphoprotein Reference proteome Repeat Transmembrane helix

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
gluconeogenesis	ISO	GO_REF
lipid transport
malate-aspartate shuttle	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

NAD+ metabolic process [inference]

malate-aspartate shuttle

nicotinamide nucleotide metabolic process [inference]

NAD+ metabolic process [inference]

malate-aspartate shuttle

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

NAD+ metabolic process [inference]

malate-aspartate shuttle

nicotinamide nucleotide metabolic process [inference]

NAD+ metabolic process [inference]

malate-aspartate shuttle

biosynthetic process [inference]

carbohydrate biosynthetic process [inference]

monosaccharide biosynthetic process [inference]

hexose biosynthetic process [inference]

gluconeogenesis

small molecule biosynthetic process [inference]

monosaccharide biosynthetic process [inference]

hexose biosynthetic process [inference]

gluconeogenesis

primary metabolic process [inference]

carbohydrate metabolic process [inference]

monosaccharide metabolic process [inference]

hexose metabolic process [inference]

glucose metabolic process [inference]

gluconeogenesis

hexose biosynthetic process [inference]

gluconeogenesis

monosaccharide biosynthetic process [inference]

hexose biosynthetic process [inference]

gluconeogenesis

carbohydrate biosynthetic process [inference]

monosaccharide biosynthetic process [inference]

hexose biosynthetic process [inference]

gluconeogenesis

nucleobase-containing compound metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

NAD+ metabolic process [inference]

malate-aspartate shuttle

nicotinamide nucleotide metabolic process [inference]

NAD+ metabolic process [inference]

malate-aspartate shuttle

small molecule metabolic process [inference]

monosaccharide metabolic process [inference]

hexose metabolic process [inference]

glucose metabolic process [inference]

gluconeogenesis

hexose biosynthetic process [inference]

gluconeogenesis

monosaccharide biosynthetic process [inference]

hexose biosynthetic process [inference]

gluconeogenesis

small molecule biosynthetic process [inference]

monosaccharide biosynthetic process [inference]

hexose biosynthetic process [inference]

gluconeogenesis

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

NAD+ metabolic process [inference]

malate-aspartate shuttle

nicotinamide nucleotide metabolic process [inference]

NAD+ metabolic process [inference]

malate-aspartate shuttle

purine-containing compound metabolic process [inference]

purine nucleotide metabolic process [inference]

NAD+ metabolic process [inference]

malate-aspartate shuttle

pyridine-containing compound metabolic process [inference]

nicotinamide nucleotide metabolic process [inference]

NAD+ metabolic process [inference]

malate-aspartate shuttle

localization [inference]

establishment of localization [inference]

transport [inference]

lipid transport

Displaying **all 2** entries
GO Term	Evidence Code	Reference
mitochondrial inner membrane	ISO	GO_REF
mitochondrial inner membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

mitochondrial inner membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
alpha-ketoglutarate transmembrane transporter activity	IMP	PMID
alpha-ketoglutarate transmembrane transporter activity	IEA	GO_REF
oxoglutarate:malate antiporter activity	ISO	GO_REF
transmembrane transporter activity

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity

active transmembrane transporter activity [inference]

secondary active transmembrane transporter activity [inference]

antiporter activity [inference]

oxoglutarate:malate antiporter activity

carboxylic acid transmembrane transporter activity [inference]

dicarboxylic acid transmembrane transporter activity [inference]

alpha-ketoglutarate transmembrane transporter activity

oxoglutarate:malate antiporter activity

malate transmembrane transporter activity [inference]

oxoglutarate:malate antiporter activity

C4-dicarboxylate transmembrane transporter activity [inference]

malate transmembrane transporter activity [inference]

oxoglutarate:malate antiporter activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAATASPGAGRMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVXNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKALIGMTAGATGAFVGPPAEVALIRMTADGRLPADQRRGYKNVFNALIRIAREEGVPTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCAIMISGLVTTAASMPVDIVKTRIQNMRMIDEKPEYKNGLDVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
52		26446791 27213235 28100784 38843836	G49108TO	GlyGen The O-GlcNAc Database
85		26446791 27213235 28100784 38843836	G49108TO	GlyGen The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Malate-aspartate shuttle	Rattus norvegicus
Organic anion transport by SLC5/17/25 transporters	Rattus norvegicus

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026