GlyCosmos Portal

Submissions

Acyl-protein thioesterase 1

Summary

UniProt ID: P97823
Gene Symbol: Apt1 Lypla1 Pla1a
Gene ID: 18777
Organism: Mus musculus (house mouse)

External Links

GlyGen: P97823
PubChem: P97823
O-GlcNAcAtlas: P97823
Re-Glyco: P97823

Annotation

Keyword: Acetylation Alternative splicing Cell membrane Cytoplasm Direct protein sequencing Endoplasmic reticulum Fatty acid metabolism Hydrolase Nucleus Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
protein depalmitoylation	ISO	GO_REF
protein depalmitoylation	IMP	PMID
fatty acid metabolic process
fatty acid transport	ISO	GO_REF
fatty acid transport	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

autophagy [inference]

macroautophagy [inference]

aggrephagy

macromolecule catabolic process [inference]

protein catabolic process [inference]

lipoprotein catabolic process [inference]

protein depalmitoylation

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

lipoprotein catabolic process [inference]

protein depalmitoylation

protein metabolic process [inference]

protein catabolic process [inference]

lipoprotein catabolic process [inference]

protein depalmitoylation

protein modification process [inference]

protein deacylation [inference]

protein depalmitoylation

lipoprotein metabolic process [inference]

lipoprotein catabolic process [inference]

protein depalmitoylation

macromolecule modification [inference]

protein modification process [inference]

protein deacylation [inference]

protein depalmitoylation

macromolecule deacylation [inference]

protein deacylation [inference]

protein depalmitoylation

macromolecule depalmitoylation [inference]

protein depalmitoylation

primary metabolic process [inference]

lipid metabolic process [inference]

fatty acid metabolic process

protein metabolic process [inference]

protein catabolic process [inference]

lipoprotein catabolic process [inference]

protein depalmitoylation

protein modification process [inference]

protein deacylation [inference]

protein depalmitoylation

lipoprotein metabolic process [inference]

lipoprotein catabolic process [inference]

protein depalmitoylation

small molecule metabolic process [inference]

organic acid metabolic process [inference]

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

fatty acid metabolic process

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to vacuole involved in autophagy

vacuolar transport [inference]

protein targeting to vacuole [inference]

protein targeting to vacuole involved in autophagy

process utilizing autophagic mechanism [inference]

autophagy [inference]

macroautophagy [inference]

aggrephagy

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to vacuole involved in autophagy

protein localization to organelle [inference]

protein localization to vacuole [inference]

protein targeting to vacuole [inference]

protein targeting to vacuole involved in autophagy

establishment of localization [inference]

transport [inference]

lipid transport [inference]

fatty acid transport

protein transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to vacuole involved in autophagy

organic anion transport [inference]

carboxylic acid transport [inference]

monocarboxylic acid transport [inference]

fatty acid transport

organic acid transport [inference]

carboxylic acid transport [inference]

monocarboxylic acid transport [inference]

fatty acid transport

intracellular transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to vacuole involved in autophagy

vacuolar transport [inference]

protein targeting to vacuole [inference]

protein targeting to vacuole involved in autophagy

establishment of protein localization [inference]

protein targeting [inference]

protein targeting to vacuole [inference]

protein targeting to vacuole involved in autophagy

protein transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to vacuole involved in autophagy

establishment of protein localization to organelle [inference]

establishment of protein localization to vacuole [inference]

protein targeting to vacuole [inference]

protein targeting to vacuole involved in autophagy

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to vacuole involved in autophagy

vacuolar transport [inference]

protein targeting to vacuole [inference]

protein targeting to vacuole involved in autophagy

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein targeting to vacuole [inference]

protein targeting to vacuole involved in autophagy

vacuolar transport [inference]

protein targeting to vacuole [inference]

protein targeting to vacuole involved in autophagy

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of protein localization [inference]

regulation of establishment of protein localization [inference]

regulation of protein transport [inference]

regulation of Golgi to plasma membrane protein transport [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of protein transport [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of establishment of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of protein localization to cell periphery [inference]

negative regulation of protein localization to plasma membrane [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of protein localization to membrane [inference]

negative regulation of protein localization to plasma membrane [inference]

negative regulation of Golgi to plasma membrane protein transport

regulation of protein localization to cell periphery [inference]

regulation of protein localization to plasma membrane [inference]

regulation of Golgi to plasma membrane protein transport [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of protein localization to plasma membrane [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of protein localization to cell periphery [inference]

negative regulation of protein localization to plasma membrane [inference]

negative regulation of Golgi to plasma membrane protein transport

regulation of protein localization to membrane [inference]

regulation of protein localization to plasma membrane [inference]

regulation of Golgi to plasma membrane protein transport [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of protein localization to plasma membrane [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of protein localization to membrane [inference]

negative regulation of protein localization to plasma membrane [inference]

negative regulation of Golgi to plasma membrane protein transport

regulation of transport [inference]

negative regulation of transport [inference]

negative regulation of protein transport [inference]

negative regulation of Golgi to plasma membrane protein transport

regulation of protein transport [inference]

regulation of Golgi to plasma membrane protein transport [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of protein transport [inference]

negative regulation of Golgi to plasma membrane protein transport

regulation of vesicle-mediated transport [inference]

regulation of Golgi to plasma membrane protein transport [inference]

negative regulation of Golgi to plasma membrane protein transport

regulation of cellular localization [inference]

regulation of protein localization to membrane [inference]

regulation of protein localization to plasma membrane [inference]

regulation of Golgi to plasma membrane protein transport [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of protein localization to plasma membrane [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of protein localization to membrane [inference]

negative regulation of protein localization to plasma membrane [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of autophagy [inference]

negative regulation of macroautophagy [inference]

negative regulation of aggrephagy

negative regulation of protein localization to membrane [inference]

negative regulation of protein localization to plasma membrane [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of transport [inference]

negative regulation of protein transport [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of protein localization to cell periphery [inference]

negative regulation of protein localization to plasma membrane [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of protein localization to membrane [inference]

negative regulation of protein localization to plasma membrane [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of establishment of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of Golgi to plasma membrane protein transport

regulation of cellular process [inference]

regulation of metabolic process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of autophagy [inference]

negative regulation of macroautophagy [inference]

negative regulation of aggrephagy

regulation of catabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of autophagy [inference]

negative regulation of macroautophagy [inference]

negative regulation of aggrephagy

regulation of autophagy [inference]

negative regulation of autophagy [inference]

negative regulation of macroautophagy [inference]

negative regulation of aggrephagy

regulation of macroautophagy [inference]

negative regulation of macroautophagy [inference]

negative regulation of aggrephagy

regulation of aggrephagy [inference]

negative regulation of aggrephagy

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of autophagy [inference]

negative regulation of macroautophagy [inference]

negative regulation of aggrephagy

negative regulation of protein localization to membrane [inference]

negative regulation of protein localization to plasma membrane [inference]

negative regulation of Golgi to plasma membrane protein transport

regulation of cellular localization [inference]

regulation of protein localization to membrane [inference]

regulation of protein localization to plasma membrane [inference]

regulation of Golgi to plasma membrane protein transport [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of protein localization to plasma membrane [inference]

negative regulation of Golgi to plasma membrane protein transport

negative regulation of protein localization to membrane [inference]

negative regulation of protein localization to plasma membrane [inference]

negative regulation of Golgi to plasma membrane protein transport

regulation of vesicle-mediated transport [inference]

regulation of Golgi to plasma membrane protein transport [inference]

negative regulation of Golgi to plasma membrane protein transport

Displaying entries **1 - 5** of 20 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
nucleoplasm	ISO	GO_REF
cytoplasm	ISS	GO_REF
cytoplasm	ISO	GO_REF GO_REF
cytoplasm	IBA	GO_REF
cytoplasm	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle membrane [inference]

nuclear membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
glycerophospholipase activity	ISS	GO_REF
glycerophospholipase activity	ISO	GO_REF
glycerophospholipase activity	IEA	GO_REF
phosphatidylcholine lysophospholipase A1 activity	ISS	GO_REF
phosphatidylcholine lysophospholipase A1 activity	ISO	GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

lipase activity

phospholipase activity [inference]

glycerophospholipase activity

A1-type glycerophospholipase activity [inference]

lysophospholipase A1 activity [inference]

phosphatidylcholine lysophospholipase A1 activity

thiolester hydrolase activity [inference]

palmitoyl-(protein) hydrolase activity

carboxylic ester hydrolase activity [inference]

A1-type glycerophospholipase activity [inference]

lysophospholipase A1 activity [inference]

phosphatidylcholine lysophospholipase A1 activity

palmitoyl hydrolase activity [inference]

palmitoyl-(protein) hydrolase activity

catalytic activity, acting on a protein [inference]

palmitoyl-(protein) hydrolase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites