GlyCosmos Portal

Submissions

Complement C1q subcomponent subunit C

Summary

UniProt ID: Q02105
Gene Symbol: C1qc C1qg
Gene ID: 12262
Organism: Mus musculus (house mouse)

External Links

PubChem: Q02105
Re-Glyco: Q02105

Annotation

Keyword: Collagen Complement pathway Disulfide bond Glycoprotein Hydroxylation Reference proteome Repeat Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
complement activation, classical pathway	ISO	GO_REF
complement activation, classical pathway	NAS	PMID
complement activation, classical pathway	IEA	GO_REF
negative regulation of granulocyte differentiation	ISO	GO_REF
negative regulation of granulocyte differentiation	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

complement activation [inference]

complement activation, classical pathway

activation of immune response [inference]

complement activation [inference]

complement activation, classical pathway

immune response [inference]

humoral immune response [inference]

complement activation [inference]

complement activation, classical pathway

innate immune response

cellular process [inference]

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component disassembly [inference]

cell junction disassembly [inference]

synapse pruning

cell junction organization [inference]

synapse organization [inference]

synapse pruning

cell junction disassembly [inference]

synapse pruning

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

immune response [inference]

humoral immune response [inference]

complement activation [inference]

complement activation, classical pathway

innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation [inference]

complement activation, classical pathway

regulation of immune response [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation [inference]

complement activation, classical pathway

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of granulocyte differentiation [inference]

negative regulation of granulocyte differentiation

regulation of macrophage differentiation [inference]

negative regulation of macrophage differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of granulocyte differentiation [inference]

negative regulation of granulocyte differentiation

regulation of macrophage differentiation [inference]

negative regulation of macrophage differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation [inference]

complement activation, classical pathway

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation [inference]

complement activation, classical pathway

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of cellular process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of response to stimulus [inference]

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation [inference]

complement activation, classical pathway

regulation of immune response [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation [inference]

complement activation, classical pathway

regulation of developmental process [inference]

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of granulocyte differentiation [inference]

negative regulation of granulocyte differentiation

regulation of macrophage differentiation [inference]

negative regulation of macrophage differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of granulocyte differentiation [inference]

negative regulation of granulocyte differentiation

regulation of macrophage differentiation [inference]

negative regulation of macrophage differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of granulocyte differentiation [inference]

negative regulation of granulocyte differentiation

regulation of macrophage differentiation [inference]

negative regulation of macrophage differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of granulocyte differentiation [inference]

negative regulation of granulocyte differentiation

regulation of macrophage differentiation [inference]

negative regulation of macrophage differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of cellular process [inference]

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of granulocyte differentiation [inference]

negative regulation of granulocyte differentiation

regulation of macrophage differentiation [inference]

negative regulation of macrophage differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of granulocyte differentiation [inference]

negative regulation of granulocyte differentiation

regulation of macrophage differentiation [inference]

negative regulation of macrophage differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of cellular process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of granulocyte differentiation [inference]

negative regulation of granulocyte differentiation

regulation of macrophage differentiation [inference]

negative regulation of macrophage differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

regulation of granulocyte differentiation [inference]

negative regulation of granulocyte differentiation

regulation of macrophage differentiation [inference]

negative regulation of macrophage differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

Displaying entries **1 - 5** of 25 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	ISO	GO_REF GO_REF
extracellular region	NAS	PMID
extracellular region	IEA	GO_REF GO_REF
extracellular region	HDA	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

collagen trimer

extracellular protein-containing complex [inference]

cellular anatomical structure [inference]

extrinsic component of membrane [inference]

extrinsic component of plasma membrane [inference]

extrinsic component of synaptic membrane [inference]

cell junction [inference]

synapse

glutamatergic synapse

other organism part [inference]

symbiont cell surface

postsynapse

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
phosphatidylserine binding	ISO	GO_REF
phosphatidylserine binding	IEA	GO_REF
IgM binding	ISO	GO_REF
IgM binding	IEA	GO_REF
IgG binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

lipid binding [inference]

phospholipid binding [inference]

phosphatidylserine binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

phosphatidylserine binding

protein-containing complex binding [inference]

immunoglobulin binding [inference]

modified amino acid binding [inference]

phosphatidylserine binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVVGPSCQPPCGLCLLLLFLLALPLRSQASAGCYGIPGMPGMPGAPGKDGHDGLQGPKGEPGIPAVPGTRGPKGQKGEPGMPGHRGKNGPRGTSGLPGDPGPRGPPGEPGVEGRYKQKHQSVFTVTRQTTQYPEANALVRFNSVVTNPQGHYNPSTGKFTCEVPGLYYFVYYTSHTANLCVHLNLNLARVASFCDHMFNSKQVSSGGVLLRLQRGDEVWLSVNDYNGMVGIEGSNSVFSGFLLFPD

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
76	O-linked (Gal...) hydroxylysine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Classical antibody-mediated complement activation	Mus musculus
Regulation of Complement cascade	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements