GlyCosmos Portal

Submissions

Fibroblast growth factor 7

Summary

UniProt ID: Q02195
Gene Symbol: Fgf-7 Fgf7 Kgf
Gene ID: 29348
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem: Q02195
Re-Glyco: Q02195

Annotation

Keyword: 3D-structure Glycoprotein Growth factor Heparin-binding Mitogen Reference proteome Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 33 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
ovarian follicle development	IMP	PMID
positive regulation of endothelial cell proliferation
phosphatidylcholine biosynthetic process	IMP	PMID
positive regulation of cell population proliferation	ISO	GO_REF
fibroblast growth factor receptor signaling pathway	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling [inference]

mesenchymal-epithelial cell signaling [inference]

regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

fibroblast growth factor receptor signaling pathway

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

phosphatidylcholine metabolic process [inference]

phosphatidylcholine biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

phospholipid biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

organophosphate metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

phosphatidylcholine metabolic process [inference]

phosphatidylcholine biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

phospholipid biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

organophosphate biosynthetic process [inference]

phospholipid biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

biosynthetic process [inference]

lipid biosynthetic process [inference]

phospholipid biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

glycerolipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

organophosphate biosynthetic process [inference]

phospholipid biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

primary metabolic process [inference]

lipid metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

phosphatidylcholine metabolic process [inference]

phosphatidylcholine biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

phospholipid biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

lipid biosynthetic process [inference]

phospholipid biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

glycerolipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

glycerolipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

phosphatidylcholine metabolic process [inference]

phosphatidylcholine biosynthetic process

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

glycerolipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

phosphatidylcholine biosynthetic process

cell population proliferation [inference]

mesenchymal cell proliferation

actin filament-based process [inference]

actin cytoskeleton organization

cellular developmental process [inference]

cell differentiation [inference]

neurogenesis

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

actin cytoskeleton organization

export from cell [inference]

secretion by cell [inference]

secretion by lung epithelial cell involved in lung growth

multicellular organismal process [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching involved in salivary gland morphogenesis

molting cycle process [inference]

hair cycle process [inference]

hair follicle morphogenesis

multicellular organismal-level homeostasis [inference]

multicellular organismal-level chemical homeostasis [inference]

surfactant homeostasis

developmental process [inference]

anatomical structure morphogenesis [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching involved in salivary gland morphogenesis

hair follicle morphogenesis

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

morphogenesis of a branching epithelium [inference]

branching involved in salivary gland morphogenesis

anatomical structure development [inference]

ovarian follicle development

animal organ development [inference]

lung development

cellular developmental process [inference]

cell differentiation [inference]

neurogenesis

locomotion [inference]

taxis [inference]

chemotaxis [inference]

positive chemotaxis

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

multicellular organismal-level chemical homeostasis [inference]

surfactant homeostasis

chemical homeostasis [inference]

multicellular organismal-level chemical homeostasis [inference]

surfactant homeostasis

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein localization to cell surface

establishment of localization [inference]

transport [inference]

secretion [inference]

secretion by cell [inference]

secretion by lung epithelial cell involved in lung growth

export from cell [inference]

secretion by cell [inference]

secretion by lung epithelial cell involved in lung growth

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

signaling [inference]

cell-cell signaling [inference]

mesenchymal-epithelial cell signaling [inference]

regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of cell motility [inference]

regulation of cell migration

regulation of epithelial cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of keratinocyte migration [inference]

positive regulation of keratinocyte migration

positive regulation of cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of epithelial cell proliferation

positive regulation of myoblast proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell division

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of morphogenesis of a branching structure [inference]

regulation of branching involved in salivary gland morphogenesis [inference]

regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling

regulation of morphogenesis of an epithelium [inference]

regulation of branching involved in salivary gland morphogenesis [inference]

regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling

regulation of animal organ morphogenesis [inference]

regulation of branching involved in salivary gland morphogenesis [inference]

regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling

regulation of synapse maturation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

fibroblast growth factor receptor signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of epithelial cell proliferation

positive regulation of myoblast proliferation

regulation of epithelial cell proliferation [inference]

regulation of endothelial cell proliferation [inference]

positive regulation of endothelial cell proliferation

regulation of keratinocyte proliferation [inference]

positive regulation of keratinocyte proliferation

positive regulation of epithelial cell proliferation

regulation of epithelial cell proliferation involved in lung morphogenesis [inference]

positive regulation of epithelial cell proliferation involved in lung morphogenesis

regulation of myoblast proliferation [inference]

positive regulation of myoblast proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of epithelial cell proliferation

positive regulation of myoblast proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell division

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of cellular component organization [inference]

regulation of synapse organization [inference]

regulation of synapse maturation

regulation of cell division [inference]

positive regulation of cell division

regulation of cell motility [inference]

regulation of cell migration

regulation of epithelial cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of keratinocyte migration [inference]

positive regulation of keratinocyte migration

positive regulation of cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of multicellular organismal process [inference]

regulation of epithelial cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of keratinocyte migration [inference]

positive regulation of keratinocyte migration

regulation of morphogenesis of a branching structure [inference]

regulation of branching involved in salivary gland morphogenesis [inference]

regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISO	GO_REF
extracellular region	IDA	PMID
obsolete extracellular space
cytoplasm	IBA	GO_REF
Golgi apparatus	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell junction [inference]

synapse [inference]

GABA-ergic synapse

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

postsynapse

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
type 2 fibroblast growth factor receptor binding	IDA	PMID
type 2 fibroblast growth factor receptor binding	IBA	GO_REF
growth factor activity	IMP	PMID
growth factor activity	IBA	GO_REF
growth factor activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

growth factor receptor binding [inference]

fibroblast growth factor receptor binding [inference]

type 2 fibroblast growth factor receptor binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

heparin binding

sulfur compound binding [inference]

heparin binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRKWILTRILPTPLYRPCFHLVCLVGTISLACNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMRNSYNIMEIMTVAVGIVAIKGVESEYYLAMNKQGELYAKKECNEDCNFKELILENHYNTSASAKWTHSGGEMFVALNQKGLPVKGKKTKKEQKTAHFLPMAIT

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
45	N-linked (GlcNAc...) asparagine			UniProt
149	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 10** entries
Pathway Name	Organism
FGFR2b ligand binding and activation	Rattus norvegicus
FRS-mediated FGFR2 signaling	Rattus norvegicus
Negative regulation of FGFR2 signaling	Rattus norvegicus
PI-3K cascade:FGFR2	Rattus norvegicus
PI3K Cascade	Rattus norvegicus
PI3K/AKT Signaling	Rattus norvegicus
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling	Rattus norvegicus
Phospholipase C-mediated cascade; FGFR2	Rattus norvegicus
RAF/MAP kinase cascade	Rattus norvegicus
SHC-mediated cascade:FGFR2	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements