GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Ribonuclease T2-like

Summary

UniProt ID: Q02933
Gene Symbol: RNY1 YPL123C
Gene ID: 855980
Organism: Saccharomyces cerevisiae S288C

External Links

Re-Glyco: Q02933

Annotation

Keyword: Cytoplasm Disulfide bond Endonuclease Glycoprotein Lyase Reference proteome Signal Vacuole

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
cell morphogenesis	IMP	PMID
RNA catabolic process	IMP	PMID
RNA catabolic process	IEA	GO_REF
mRNA catabolic process	IMP	PMID
apoptotic process	IGI	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

nucleic acid catabolic process [inference]

RNA catabolic process

mRNA catabolic process

nucleobase-containing compound catabolic process [inference]

nucleic acid catabolic process [inference]

RNA catabolic process

mRNA catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

nucleic acid catabolic process [inference]

RNA catabolic process

mRNA catabolic process

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA catabolic process

mRNA catabolic process

mRNA metabolic process [inference]

mRNA catabolic process

nucleic acid catabolic process [inference]

RNA catabolic process

mRNA catabolic process

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound catabolic process [inference]

nucleic acid catabolic process [inference]

RNA catabolic process

mRNA catabolic process

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA catabolic process

mRNA catabolic process

mRNA metabolic process [inference]

mRNA catabolic process

nucleic acid catabolic process [inference]

RNA catabolic process

mRNA catabolic process

cell death [inference]

programmed cell death [inference]

apoptotic process

developmental process [inference]

anatomical structure morphogenesis [inference]

cell morphogenesis

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
fungal-type vacuole	IDA	PMID
extracellular region	IDA	PMID
vacuole	IDA	PMID
vacuolar lumen	IEA	GO_REF
cytosol	IDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

vacuolar lumen

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

storage vacuole [inference]

fungal-type vacuole

lytic vacuole [inference]

fungal-type vacuole

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

storage vacuole [inference]

fungal-type vacuole

lytic vacuole [inference]

fungal-type vacuole

Displaying **all 5** entries
GO Term	Evidence Code	Reference
RNA binding	IEA	GO_REF
RNA endonuclease activity	IDA	PMID
RNA endonuclease activity	IMP	PMID
hydrolase activity
ribonuclease T2 activity	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity

lyase activity [inference]

phosphorus-oxygen lyase activity [inference]

ribonuclease T2 activity

catalytic activity, acting on a nucleic acid [inference]

nuclease activity [inference]

endonuclease activity [inference]

RNA endonuclease activity

ribonuclease T2 activity

RNA nuclease activity [inference]

RNA endonuclease activity

ribonuclease T2 activity

catalytic activity, acting on RNA [inference]

RNA nuclease activity [inference]

RNA endonuclease activity

ribonuclease T2 activity

binding [inference]

nucleic acid binding [inference]

RNA binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLLKNLHSLLQLPIFSNGADKGIEPNCPINIPLSCSNKTDIDNSCCFEYPGGIFLQTQFWNYFPSKNDLNETELVKELGPLDSFTIHGLWPDNCHGGYQQFCNRSLQIDDVYYLLHDKKFNNNDTSLQISGEKLLEYLDLYWKSNNGNHESLWIHEFNKHGTCISTIRPECYTEWGANSVDRKRAVYDYFRITYNLFKKLDTFSTLEKNNIVPSVDNSYSLEQIEAALSKEFEGKKVFIGCDRHNSLNEVWYYNHLKGSLLSEMFVPMDSLAIRTNCKKDGIKFFPKGYVPTFRRRPNKGARYRGVVRLSNINNGDQMQGFLIKNGHWMSQGTPANYELIKSPYGNYYLRTNQGFCDIISSSSNELVCKFRNIKDAGQFDFDPTKGGDGYIGYSGNYNWGGDTYPRRRNQSPIFSVDDEQNSKKYKFKLKFIKN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
37	N-linked (GlcNAc...) asparagine			UniProt
70	N-linked (GlcNAc...) asparagine			UniProt
103	N-linked (GlcNAc...) asparagine			UniProt
123	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Neutrophil degranulation	Saccharomyces cerevisiae

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026