GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

C-C motif chemokine 7

Summary

UniProt ID: Q03366
Gene Symbol: Ccl7 Fic Mcp3 Scya7
Gene ID: 20306
Organism: Mus musculus (house mouse)

External Links

Re-Glyco: Q03366

Annotation

Keyword: Chemotaxis Cytokine Disulfide bond Glycoprotein Heparin-binding Inflammatory response Pyrrolidone carboxylic acid Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 24 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
inflammatory response	ISO	GO_REF
inflammatory response	IBA	GO_REF
cytoskeleton organization	ISO	GO_REF
cytoskeleton organization	IEA	GO_REF
canonical NF-kappaB signal transduction	ISO	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

humoral immune response [inference]

antimicrobial humoral response [inference]

antimicrobial humoral immune response mediated by antimicrobial peptide

leukocyte migration [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

eosinophil chemotaxis

myeloid leukocyte migration [inference]

granulocyte migration [inference]

granulocyte chemotaxis [inference]

eosinophil chemotaxis

eosinophil migration [inference]

eosinophil chemotaxis

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

chemokine-mediated signaling pathway

G protein-coupled receptor signaling pathway [inference]

chemokine-mediated signaling pathway

signal transduction involved in regulation of gene expression

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

canonical NF-kappaB signal transduction

cell motility [inference]

cell migration [inference]

leukocyte migration [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

eosinophil chemotaxis

myeloid leukocyte migration [inference]

granulocyte migration [inference]

granulocyte chemotaxis [inference]

eosinophil chemotaxis

eosinophil migration [inference]

eosinophil chemotaxis

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

eosinophil chemotaxis

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to oxygen-containing compound [inference]

cellular response to alcohol [inference]

cellular response to ethanol

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization

locomotion [inference]

taxis [inference]

chemotaxis [inference]

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

granulocyte chemotaxis [inference]

eosinophil chemotaxis

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

antimicrobial humoral immune response mediated by antimicrobial peptide

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

antimicrobial humoral immune response mediated by antimicrobial peptide

immune response [inference]

humoral immune response [inference]

antimicrobial humoral response [inference]

antimicrobial humoral immune response mediated by antimicrobial peptide

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

antimicrobial humoral immune response mediated by antimicrobial peptide

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

antimicrobial humoral immune response mediated by antimicrobial peptide

response to abiotic stimulus [inference]

response to radiation [inference]

response to ionizing radiation [inference]

response to gamma radiation

response to chemical [inference]

cellular response to chemical stimulus [inference]

cellular response to oxygen-containing compound [inference]

cellular response to alcohol [inference]

cellular response to ethanol

response to oxygen-containing compound [inference]

response to alcohol [inference]

response to ethanol [inference]

cellular response to ethanol

cellular response to alcohol [inference]

cellular response to ethanol

cellular response to oxygen-containing compound [inference]

cellular response to alcohol [inference]

cellular response to ethanol

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to oxygen-containing compound [inference]

cellular response to alcohol [inference]

cellular response to ethanol

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of lymphocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of natural killer cell chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of mononuclear cell migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of lymphocyte migration [inference]

regulation of lymphocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of natural killer cell chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of chemotaxis [inference]

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of lymphocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of natural killer cell chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of lymphocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of natural killer cell chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of mononuclear cell migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of lymphocyte migration [inference]

regulation of lymphocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of natural killer cell chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of cell migration

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of locomotion [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of cellular process [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of response to stimulus [inference]

positive regulation of defense response [inference]

positive regulation of inflammatory response

positive regulation of response to external stimulus [inference]

positive regulation of inflammatory response

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in inflammatory response

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in inflammatory response

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in inflammatory response

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of inflammatory response

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of inflammatory response [inference]

positive regulation of inflammatory response

regulation of chemotaxis [inference]

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of lymphocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of natural killer cell chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of response to stimulus [inference]

positive regulation of defense response [inference]

positive regulation of inflammatory response

positive regulation of response to external stimulus [inference]

positive regulation of inflammatory response

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of response to stress [inference]

regulation of defense response [inference]

positive regulation of defense response [inference]

positive regulation of inflammatory response

regulation of inflammatory response [inference]

positive regulation of inflammatory response

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of cell morphogenesis [inference]

regulation of cell shape

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

chemokine-mediated signaling pathway

G protein-coupled receptor signaling pathway [inference]

chemokine-mediated signaling pathway

signal transduction involved in regulation of gene expression

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

canonical NF-kappaB signal transduction

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in inflammatory response

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in inflammatory response

regulation of cytokine production involved in inflammatory response [inference]

negative regulation of cytokine production involved in inflammatory response

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in inflammatory response

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in inflammatory response

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in inflammatory response

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in inflammatory response

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in inflammatory response

regulation of cytokine production involved in inflammatory response [inference]

negative regulation of cytokine production involved in inflammatory response

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in inflammatory response

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in inflammatory response

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in inflammatory response

positive regulation of cellular process [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in inflammatory response

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in inflammatory response

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of lymphocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of natural killer cell chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of mononuclear cell migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of lymphocyte migration [inference]

regulation of lymphocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of natural killer cell chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of cell migration

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of lymphocyte migration [inference]

positive regulation of lymphocyte chemotaxis [inference]

positive regulation of natural killer cell chemotaxis

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in inflammatory response

regulation of cytokine production involved in inflammatory response [inference]

negative regulation of cytokine production involved in inflammatory response

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of cytokine production involved in inflammatory response

regulation of biological quality [inference]

regulation of cell shape

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
chemokine activity	ISO	GO_REF
chemokine activity	IBA	GO_REF
chemokine activity	IEA	GO_REF GO_REF
heparin binding
CCR1 chemokine receptor binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

G protein-coupled receptor binding [inference]

chemokine receptor binding [inference]

chemokine activity

CCR chemokine receptor binding

cytokine receptor binding [inference]

chemokine receptor binding [inference]

chemokine activity

CCR chemokine receptor binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

heparin binding

sulfur compound binding [inference]

heparin binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity [inference]

chemokine activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity [inference]

chemokine activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRISATLLCLLLIAAAFSIQVWAQPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
29	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Chemokine receptors bind chemokines	Mus musculus

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026