GlyCosmos Portal

Submissions

Rod outer segment membrane protein 1

Summary

UniProt ID

Q03395

Gene Symbol

ROM1
TSPAN23

Gene ID

6094

Organism

Homo sapiens (human)

External Links

The O-GlcNAc Database: Q03395
Re-Glyco: Q03395

Annotation

Keyword: 3D-structure Cell adhesion Cell projection Disease variant Disulfide bond Proteomics identification Reference proteome Retinitis pigmentosa Transmembrane helix Vision

Gene Ontology (GO)

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
cell adhesion
visual perception	TAS	PMID
visual perception	IEA	GO_REF
regulation of gene expression
photoreceptor cell outer segment organization

GO Hierarchy

biological process

cellular process [inference]

cell adhesion

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation [inference]

photoreceptor cell differentiation [inference]

eye photoreceptor cell differentiation [inference]

camera-type eye photoreceptor cell differentiation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

protein-containing complex assembly [inference]

protein complex oligomerization [inference]

photoreceptor cell outer segment organization

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

protein complex oligomerization [inference]

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

sensory perception [inference]

sensory perception of light stimulus [inference]

visual perception

developmental process [inference]

anatomical structure development [inference]

system development [inference]

vasculature development [inference]

retina vasculature development in camera-type eye

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation [inference]

photoreceptor cell differentiation [inference]

eye photoreceptor cell differentiation [inference]

camera-type eye photoreceptor cell differentiation

response to stimulus [inference]

response to external stimulus [inference]

detection of external stimulus [inference]

detection of light stimulus [inference]

detection of light stimulus involved in sensory perception [inference]

detection of light stimulus involved in visual perception

response to abiotic stimulus [inference]

response to radiation [inference]

response to light stimulus [inference]

detection of light stimulus [inference]

detection of light stimulus involved in sensory perception [inference]

detection of light stimulus involved in visual perception

detection of abiotic stimulus [inference]

detection of light stimulus [inference]

detection of light stimulus involved in sensory perception [inference]

detection of light stimulus involved in visual perception

detection of stimulus [inference]

detection of external stimulus [inference]

detection of light stimulus [inference]

detection of light stimulus involved in sensory perception [inference]

detection of light stimulus involved in visual perception

detection of abiotic stimulus [inference]

detection of light stimulus [inference]

detection of light stimulus involved in sensory perception [inference]

detection of light stimulus involved in visual perception

detection of stimulus involved in sensory perception [inference]

detection of light stimulus involved in sensory perception [inference]

detection of light stimulus involved in visual perception

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein localization to organelle [inference]

protein localization to cilium [inference]

protein localization to non-motile cilium [inference]

protein localization to photoreceptor outer segment

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

Displaying **all 3** entries
GO Term	Evidence Code	Reference
plasma membrane	TAS	PMID
plasma membrane	IBA	GO_REF
photoreceptor outer segment membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle membrane [inference]

bounding membrane of organelle [inference]

ciliary membrane [inference]

photoreceptor outer segment membrane

plasma membrane region [inference]

cell projection membrane [inference]

ciliary membrane [inference]

photoreceptor outer segment membrane

Displaying 1 entry
GO Term	Evidence Code	Reference
protein homodimerization activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAPVLPLVLPLQPRIRLAQGLWLLSWLLALAGGVILLCSGHLLVQLRHLGTFLAPSCQFPVLPQAALAAGAVALGTGLVGVGASRASLNAALYPPWRGVLGPLLVAGTAGGGGLLVVGLGLALALPGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGTLGSMLAVTFLLQALVLLGLRYLQTALEGLGGVIDAGGETQGYLFPSGLKDMLKTAWLQGGVACRPAPEEAPPGEAPPKEDLSEA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites