GlyCosmos Portal

Submissions

Folate receptor beta

Summary

UniProt ID: Q05685
Gene Symbol: Fbp2 Folbp2 Folr2
Gene ID: 14276
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0003888
PubChem: Q05685
Re-Glyco: Q05685

Annotation

Keyword: Cell membrane Disulfide bond Folate-binding GPI-anchor Receptor Reference proteome Signal Transport

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
post-translational protein targeting to endoplasmic reticulum membrane	TAS	PMID
cell adhesion
fusion of sperm to egg plasma membrane involved in single fertilization
positive regulation of cell population proliferation	IEA	GO_REF
folic acid transport	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell adhesion

cell recognition [inference]

cell-cell recognition [inference]

sperm-egg recognition

cellular process involved in reproduction in multicellular organism [inference]

fusion of sperm to egg plasma membrane involved in single fertilization

cellular localization [inference]

localization within membrane [inference]

establishment of protein localization to membrane [inference]

protein targeting to membrane [inference]

post-translational protein targeting to endoplasmic reticulum membrane

reproductive process [inference]

multicellular organismal reproductive process [inference]

cellular process involved in reproduction in multicellular organism [inference]

fusion of sperm to egg plasma membrane involved in single fertilization

localization [inference]

establishment of localization [inference]

transport [inference]

organic anion transport [inference]

carboxylic acid transport [inference]

dicarboxylic acid transport [inference]

folic acid transport

organic acid transport [inference]

carboxylic acid transport [inference]

dicarboxylic acid transport [inference]

folic acid transport

vitamin transport [inference]

folic acid transport

nitrogen compound transport [inference]

modified amino acid transport [inference]

folic acid transport

establishment of protein localization [inference]

protein targeting [inference]

protein targeting to membrane [inference]

post-translational protein targeting to endoplasmic reticulum membrane

protein targeting to ER [inference]

post-translational protein targeting to endoplasmic reticulum membrane

establishment of protein localization to organelle [inference]

establishment of protein localization to endoplasmic reticulum [inference]

protein targeting to ER [inference]

post-translational protein targeting to endoplasmic reticulum membrane

establishment of protein localization to membrane [inference]

protein targeting to membrane [inference]

post-translational protein targeting to endoplasmic reticulum membrane

cellular localization [inference]

localization within membrane [inference]

establishment of protein localization to membrane [inference]

protein targeting to membrane [inference]

post-translational protein targeting to endoplasmic reticulum membrane

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

regulation of cellular process [inference]

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

Displaying **all 5** entries
GO Term	Evidence Code	Reference
external side of plasma membrane	ISS	GO_REF
external side of plasma membrane	ISO	GO_REF
external side of plasma membrane	IEA	GO_REF
cell surface	ISO	GO_REF
cell surface	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell surface

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
folic acid binding	ISS	GO_REF
folic acid binding	ISO	GO_REF
folic acid binding	TAS	PMID
folic acid binding	IEA	GO_REF
signaling receptor activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

small molecule binding [inference]

vitamin binding [inference]

folic acid binding

ion binding [inference]

anion binding [inference]

carboxylic acid binding [inference]

folic acid binding

organic acid binding [inference]

carboxylic acid binding [inference]

folic acid binding

heterocyclic compound binding [inference]

folic acid binding

modified amino acid binding [inference]

folic acid binding

cargo receptor activity [inference]

folic acid receptor activity

molecular transducer activity [inference]

signaling receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAWKQTPLLLLVYMVTTGSGRDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCSVNTSQELHKADSRLYFNWDHCGKMEPACKSHFIQDSCLYECSPNLGPWIQQVDQSWRKERFLDVPLCKEDCHQWWEACRTSFTCKRDWHKGWDWSSGINKCPNTAPCHTFEYYFPTPASLCEGLWSHSYKVSNYSRGSGRCIQMWFDSTQGNPNEDVVKFYASFMTSGTVPHAAVLLVPSLAPVLSLWLPG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
62	N-linked (GlcNAc...) asparagine			GlycoProtDB UniProt
193	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Metabolism of folate and pterines	Mus musculus
Neutrophil degranulation	Mus musculus
Post-translational modification: synthesis of GPI-anchored proteins	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements