GlyCosmos Portal

Submissions

ADP/ATP translocase 1

Summary

UniProt ID: Q05962
Gene Symbol: Slc25a4 Aac1 Ant1
Gene ID: 85333
Organism: Rattus norvegicus (Norway rat)

External Links

GlyGen: Q05962
PubChem: Q05962
The O-GlcNAc Database: Q05962
RaftProt: Q05962
O-GlcNAcAtlas: Q05962
Re-Glyco: Q05962

Annotation

Keyword: ATP-binding Acetylation Antiport Direct protein sequencing Methylation Mitochondrion inner membrane Phosphoprotein Reference proteome Repeat S-nitrosylation Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 24 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
liver development	IEP	PMID
heart development	IEP	PMID
apoptotic mitochondrial changes	ISO	GO_REF
negative regulation of cardiac muscle cell apoptotic process	IDA	PMID
ADP transport	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

transmembrane transport [inference]

purine-containing compound transmembrane transport [inference]

nucleotide transmembrane transport [inference]

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

mitochondrion organization [inference]

apoptotic mitochondrial changes

regulation of mitochondrial membrane permeability involved in apoptotic process [inference]

negative regulation of mitochondrial membrane permeability involved in apoptotic process

multicellular organismal process [inference]

multicellular organismal-level homeostasis [inference]

temperature homeostasis [inference]

adaptive thermogenesis

developmental process [inference]

anatomical structure development [inference]

animal organ development [inference]

heart development

gland development [inference]

liver development

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

temperature homeostasis [inference]

adaptive thermogenesis

response to stimulus [inference]

response to chemical [inference]

response to peptide [inference]

response to cytokine [inference]

response to interleukin-1

localization [inference]

establishment of localization [inference]

transport [inference]

organic anion transport [inference]

ADP transport

mitochondrial ADP transmembrane transport

ATP transport [inference]

mitochondrial ATP transmembrane transport

organophosphate ester transport [inference]

nucleotide transport [inference]

purine nucleotide transport [inference]

purine ribonucleotide transport [inference]

ADP transport

mitochondrial ADP transmembrane transport

ATP transport [inference]

mitochondrial ATP transmembrane transport

adenine nucleotide transport [inference]

ADP transport

mitochondrial ADP transmembrane transport

ATP transport [inference]

mitochondrial ATP transmembrane transport

nucleotide transmembrane transport [inference]

transmembrane transport [inference]

purine-containing compound transmembrane transport [inference]

nucleotide transmembrane transport [inference]

nitrogen compound transport [inference]

nucleobase-containing compound transport [inference]

nucleotide transport [inference]

purine nucleotide transport [inference]

purine ribonucleotide transport [inference]

ADP transport

mitochondrial ADP transmembrane transport

ATP transport [inference]

mitochondrial ATP transmembrane transport

adenine nucleotide transport [inference]

ADP transport

mitochondrial ADP transmembrane transport

ATP transport [inference]

mitochondrial ATP transmembrane transport

nucleotide transmembrane transport [inference]

purine-containing compound transmembrane transport [inference]

carbohydrate derivative transport [inference]

purine ribonucleotide transport [inference]

ADP transport

mitochondrial ADP transmembrane transport

ATP transport [inference]

mitochondrial ATP transmembrane transport

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of localization [inference]

regulation of transport [inference]

regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of growth [inference]

regulation of cell growth [inference]

positive regulation of cell growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of cell growth involved in cardiac muscle cell development [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of growth [inference]

positive regulation of cell growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of developmental growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of developmental growth [inference]

regulation of organ growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of cell growth involved in cardiac muscle cell development [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of developmental growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of biological process [inference]

positive regulation of growth [inference]

positive regulation of cell growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of developmental growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of autophagy [inference]

positive regulation of macroautophagy [inference]

positive regulation of mitophagy

positive regulation of autophagy of mitochondrion [inference]

positive regulation of mitophagy

positive regulation of cell growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of cell differentiation [inference]

positive regulation of muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of developmental growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of multicellular organismal process [inference]

positive regulation of muscle hypertrophy [inference]

positive regulation of cardiac muscle hypertrophy [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of programmed necrotic cell death [inference]

negative regulation of necroptotic process

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of muscle adaptation [inference]

regulation of cardiac muscle hypertrophy [inference]

positive regulation of cardiac muscle hypertrophy [inference]

positive regulation of cell growth involved in cardiac muscle cell development

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of developmental process [inference]

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of muscle cell differentiation [inference]

positive regulation of muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of striated muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of developmental growth [inference]

regulation of organ growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of cell growth involved in cardiac muscle cell development [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of developmental growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of developmental growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of multicellular organismal development [inference]

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of cell growth involved in cardiac muscle cell development [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of metabolic process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of autophagy [inference]

positive regulation of macroautophagy [inference]

positive regulation of mitophagy

positive regulation of autophagy of mitochondrion [inference]

positive regulation of mitophagy

regulation of catabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of autophagy [inference]

positive regulation of macroautophagy [inference]

positive regulation of mitophagy

positive regulation of autophagy of mitochondrion [inference]

positive regulation of mitophagy

regulation of autophagy [inference]

positive regulation of autophagy [inference]

positive regulation of macroautophagy [inference]

positive regulation of mitophagy

positive regulation of autophagy of mitochondrion [inference]

positive regulation of mitophagy

regulation of macroautophagy [inference]

positive regulation of macroautophagy [inference]

positive regulation of mitophagy

regulation of mitophagy [inference]

positive regulation of mitophagy

regulation of autophagy of mitochondrion [inference]

regulation of mitophagy [inference]

positive regulation of mitophagy

positive regulation of autophagy of mitochondrion [inference]

positive regulation of mitophagy

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

regulation of muscle cell apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

regulation of striated muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

regulation of cardiac muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

negative regulation of apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of programmed necrotic cell death [inference]

negative regulation of necroptotic process

regulation of programmed necrotic cell death [inference]

regulation of necroptotic process [inference]

negative regulation of necroptotic process

negative regulation of programmed necrotic cell death [inference]

negative regulation of necroptotic process

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of muscle cell differentiation [inference]

positive regulation of muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of striated muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of autophagy [inference]

positive regulation of macroautophagy [inference]

positive regulation of mitophagy

positive regulation of autophagy of mitochondrion [inference]

positive regulation of mitophagy

positive regulation of cell growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of cell differentiation [inference]

positive regulation of muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cell growth involved in cardiac muscle cell development

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of programmed necrotic cell death [inference]

negative regulation of necroptotic process

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of cellular component organization [inference]

regulation of cell growth [inference]

positive regulation of cell growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of cell growth involved in cardiac muscle cell development [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of organelle organization [inference]

negative regulation of organelle organization [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of mitochondrion organization [inference]

regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of muscle system process [inference]

regulation of muscle hypertrophy [inference]

regulation of cardiac muscle hypertrophy [inference]

positive regulation of cardiac muscle hypertrophy [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of muscle hypertrophy [inference]

positive regulation of cardiac muscle hypertrophy [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of muscle adaptation [inference]

regulation of cardiac muscle hypertrophy [inference]

positive regulation of cardiac muscle hypertrophy [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of organ growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of cell growth involved in cardiac muscle cell development [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of multicellular organismal process [inference]

positive regulation of muscle hypertrophy [inference]

positive regulation of cardiac muscle hypertrophy [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of multicellular organismal development [inference]

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of cell growth involved in cardiac muscle cell development [inference]

positive regulation of cell growth involved in cardiac muscle cell development

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cell growth involved in cardiac muscle cell development

regulation of biological quality [inference]

regulation of membrane permeability [inference]

regulation of mitochondrial membrane permeability

negative regulation of mitochondrial membrane permeability [inference]

regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of mitochondrial membrane permeability involved in apoptotic process [inference]

negative regulation of mitochondrial membrane permeability involved in apoptotic process

negative regulation of membrane permeability [inference]

negative regulation of mitochondrial membrane permeability [inference]

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrion	ISO	GO_REF
mitochondrial outer membrane	IDA	PMID
mitochondrial inner membrane	ISS	GO_REF
mitochondrial inner membrane	ISO	GO_REF
mitochondrial inner membrane	IDA	PMID PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

pore complex [inference]

mitochondrial permeability transition pore complex

mitochondrial protein-containing complex [inference]

mitochondrial permeability transition pore complex

cellular anatomical structure [inference]

membrane

outer membrane [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane

bounding membrane of organelle [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

membrane microdomain [inference]

membrane raft

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
ATP:ADP antiporter activity	ISS	GO_REF
ATP:ADP antiporter activity	ISO	GO_REF
ATP:ADP antiporter activity	IEA	GO_REF
proton transmembrane transporter activity	ISO	GO_REF
oxidative phosphorylation uncoupler activity	ISS	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity [inference]

proton transmembrane transporter activity

organophosphate ester transmembrane transporter activity [inference]

nucleotide transmembrane transporter activity [inference]

purine nucleotide transmembrane transporter activity [inference]

adenine nucleotide transmembrane transporter activity [inference]

ATP transmembrane transporter activity [inference]

ATP:ADP antiporter activity

ADP transmembrane transporter activity [inference]

ATP:ADP antiporter activity

purine ribonucleotide transmembrane transporter activity [inference]

ATP transmembrane transporter activity [inference]

ATP:ADP antiporter activity

ADP transmembrane transporter activity [inference]

ATP:ADP antiporter activity

nucleobase-containing compound transmembrane transporter activity [inference]

nucleotide transmembrane transporter activity [inference]

purine nucleotide transmembrane transporter activity [inference]

adenine nucleotide transmembrane transporter activity [inference]

ATP transmembrane transporter activity [inference]

ATP:ADP antiporter activity

ADP transmembrane transporter activity [inference]

ATP:ADP antiporter activity

purine ribonucleotide transmembrane transporter activity [inference]

ATP transmembrane transporter activity [inference]

ATP:ADP antiporter activity

ADP transmembrane transporter activity [inference]

ATP:ADP antiporter activity

oxidative phosphorylation uncoupler activity

active transmembrane transporter activity [inference]

secondary active transmembrane transporter activity [inference]

antiporter activity [inference]

ATP:ADP antiporter activity

carbohydrate derivative transmembrane transporter activity [inference]

purine ribonucleotide transmembrane transporter activity [inference]

ATP transmembrane transporter activity [inference]

ATP:ADP antiporter activity

ADP transmembrane transporter activity [inference]

ATP:ADP antiporter activity

binding [inference]

protein binding [inference]

enzyme binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGDQALSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGRKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	PubMed ID	GlyTouCan ID	Source
22	18683930 26446791 27213235 38843836	G49108TO	GlyGen The O-GlcNAc Database
69	18683930 26446791 27213235 38843836	G49108TO	GlyGen The O-GlcNAc Database
150	18683930 26446791 27213235 38843836	G49108TO	GlyGen The O-GlcNAc Database
167	18683930 26446791 27213235 38843836	G49108TO	GlyGen The O-GlcNAc Database