GlyCosmos Portal

Submissions

Proheparin-binding EGF-like growth factor

Summary

UniProt ID: Q06186
Gene Symbol: Hbegf Dtr Hegfl
Gene ID: 15200
Organism: Mus musculus (house mouse)

External Links

PubChem: Q06186
Re-Glyco: Q06186

Annotation

Keyword: Cell membrane Disulfide bond EGF-like domain Glycoprotein Growth factor Heparin-binding Reference proteome Secreted Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 27 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
angiogenesis	NAS	PMID
blastocyst growth	TAS	PMID
epidermal growth factor receptor signaling pathway	ISO	PMID GO_REF GO_REF
epidermal growth factor receptor signaling pathway	IDA	PMID
epidermal growth factor receptor signaling pathway	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

ERBB signaling pathway [inference]

epidermal growth factor receptor signaling pathway

ERBB2-EGFR signaling pathway

ERBB2 signaling pathway [inference]

ERBB4 signaling pathway [inference]

ERBB2-ERBB4 signaling pathway

cell motility [inference]

cell migration

wound healing, spreading of cells [inference]

wound healing, spreading of epidermal cells

cell chemotaxis

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

angiogenesis

growth [inference]

developmental growth [inference]

blastocyst growth

locomotion [inference]

taxis [inference]

chemotaxis [inference]

cell chemotaxis

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of intracellular signal transduction [inference]

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of growth [inference]

regulation of cell growth [inference]

positive regulation of cell growth

positive regulation of growth [inference]

positive regulation of cell growth

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of epithelial cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of keratinocyte migration [inference]

positive regulation of keratinocyte migration

positive regulation of cell migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of growth [inference]

positive regulation of cell growth

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of smooth muscle cell proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of cell growth

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of response to wounding [inference]

positive regulation of wound healing

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of protein metabolic process [inference]

negative regulation of glycoprotein metabolic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of intracellular signal transduction [inference]

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of response to wounding [inference]

positive regulation of wound healing

regulation of response to stress [inference]

regulation of response to wounding [inference]

regulation of wound healing [inference]

positive regulation of wound healing

positive regulation of response to wounding [inference]

positive regulation of wound healing

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

ERBB signaling pathway [inference]

epidermal growth factor receptor signaling pathway

ERBB2-EGFR signaling pathway

ERBB2 signaling pathway [inference]

ERBB4 signaling pathway [inference]

ERBB2-ERBB4 signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of intracellular signal transduction [inference]

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of macromolecule biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of glycoprotein biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of protein metabolic process [inference]

negative regulation of glycoprotein metabolic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of glycoprotein biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of protein metabolic process [inference]

negative regulation of glycoprotein metabolic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of protein metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of glycoprotein metabolic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of glycoprotein metabolic process [inference]

regulation of glycoprotein biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of glycoprotein metabolic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of glycoprotein metabolic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of glycoprotein metabolic process [inference]

regulation of glycoprotein biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of glycoprotein metabolic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of smooth muscle cell proliferation

regulation of smooth muscle cell proliferation [inference]

positive regulation of smooth muscle cell proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of smooth muscle cell proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of cell growth

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycoprotein biosynthetic process

negative regulation of protein metabolic process [inference]

negative regulation of glycoprotein metabolic process [inference]

negative regulation of glycoprotein biosynthetic process

regulation of cellular component organization [inference]

regulation of cell growth [inference]

positive regulation of cell growth

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of epithelial cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of keratinocyte migration [inference]

positive regulation of keratinocyte migration

positive regulation of cell migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of multicellular organismal process [inference]

regulation of epithelial cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of keratinocyte migration [inference]

positive regulation of keratinocyte migration

regulation of system process [inference]

regulation of blood circulation [inference]

regulation of heart contraction

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISO	PMID GO_REF
extracellular region	TAS	Reactome
extracellular region	IDA	PMID PMID PMID
extracellular region	IEA	GO_REF GO_REF
obsolete extracellular space

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
epidermal growth factor receptor binding	ISO	GO_REF
epidermal growth factor receptor binding	IDA	PMID
epidermal growth factor receptor binding	IBA	GO_REF
epidermal growth factor receptor binding	IEA	GO_REF
growth factor activity	ISO	GO_REF GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

growth factor receptor binding [inference]

epidermal growth factor receptor binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

heparin binding

sulfur compound binding [inference]

heparin binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

kinase regulator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

protein kinase regulator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

receptor ligand activity

growth factor activity

molecular function activator activity [inference]

enzyme activator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein tyrosine kinase activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

signaling receptor activator activity [inference]

transmembrane receptor protein tyrosine kinase activator activity

receptor ligand activity

growth factor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKLLPSVMLKLFLAAVLSALVTGESLERLRRGLAAATSNPDPPTGSTNQLLPTGGDRAQGVQDLEGTDLNLFKVAFSSKPQGLATPSKERNGKKKKKGKGLGKKRDPCLRKYKDYCIHGECRYLQEFRTPSCKCLPGYHGHRCHGLTLPVENPLYTYDHTTVLAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDLESEEKVKLGVASSH

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
85	O-linked (GalNAc...) threonine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 24 in total

1

2

3

Next ›

Last »
Pathway Name	Organism
Cargo recognition for clathrin-mediated endocytosis	Mus musculus
Clathrin-mediated endocytosis	Mus musculus
Downregulation of ERBB2 signaling	Mus musculus
EGFR Transactivation by Gastrin	Mus musculus
EGFR downregulation	Mus musculus
EGFR interacts with phospholipase C-gamma	Mus musculus
ERBB2 Activates PTK6 Signaling	Mus musculus
ERBB2 Regulates Cell Motility	Mus musculus
Extra-nuclear estrogen signaling	Mus musculus
GAB1 signalosome	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements