GlyCosmos Portal

Submissions

Cytochrome P450 1A1

Summary

UniProt ID: Q06367
Gene Symbol: CYP1A1
Gene ID: 100135512
Organism: Cavia porcellus (domestic guinea pig)

External Links

Re-Glyco: Q06367

Annotation

Keyword: Cytoplasm Direct protein sequencing Glycoprotein Heme Lyase Microsome Mitochondrion inner membrane Monooxygenase Reference proteome Steroid biosynthesis

Gene Ontology (GO)

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
long-chain fatty acid metabolic process	IEA	GO_REF
lipid hydroxylation	IEA	GO_REF
steroid biosynthetic process
xenobiotic metabolic process	IEA	GO_REF
estrogen metabolic process	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

xenobiotic metabolic process

biosynthetic process [inference]

lipid biosynthetic process [inference]

steroid biosynthetic process

hormone biosynthetic process

reactive oxygen species biosynthetic process [inference]

hydrogen peroxide biosynthetic process

secondary metabolic process [inference]

toxin metabolic process

ketone metabolic process [inference]

progesterone metabolic process

hormone metabolic process [inference]

C21-steroid hormone metabolic process [inference]

progesterone metabolic process

primary metabolic process [inference]

lipid metabolic process [inference]

fatty acid metabolic process [inference]

long-chain fatty acid metabolic process

isoprenoid metabolic process [inference]

terpenoid metabolic process [inference]

diterpenoid metabolic process [inference]

retinoid metabolic process [inference]

retinol metabolic process

steroid metabolic process [inference]

steroid biosynthetic process

C21-steroid hormone metabolic process [inference]

progesterone metabolic process

lipid biosynthetic process [inference]

steroid biosynthetic process

lipid modification [inference]

lipid hydroxylation

small molecule metabolic process [inference]

alcohol metabolic process [inference]

primary alcohol metabolic process [inference]

retinol metabolic process

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

fatty acid metabolic process [inference]

long-chain fatty acid metabolic process

reactive oxygen species metabolic process [inference]

hydrogen peroxide metabolic process [inference]

hydrogen peroxide biosynthetic process

reactive oxygen species biosynthetic process [inference]

hydrogen peroxide biosynthetic process

olefinic compound metabolic process [inference]

response to stimulus [inference]

response to chemical [inference]

response to toxic substance

biological regulation [inference]

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone metabolic process [inference]

C21-steroid hormone metabolic process [inference]

progesterone metabolic process

Displaying **all 4** entries
GO Term	Evidence Code	Reference
mitochondrial inner membrane	ISS	GO_REF
mitochondrial inner membrane	IEA	GO_REF
endoplasmic reticulum membrane	ISS	GO_REF
endoplasmic reticulum membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

endoplasmic reticulum membrane

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

mitochondrial inner membrane

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
steroid 17-alpha-monooxygenase activity	IEA	GO_REF
iron ion binding	IEA	GO_REF
arachidonate monooxygenase activity	IEA	GO_REF
heme binding	IEA	GO_REF
Hsp70 protein binding	ISS	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

monooxygenase activity [inference]

arachidonate monooxygenase activity

steroid hydroxylase activity [inference]

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen [inference]

fatty acid omega-hydroxylase activity [inference]

long-chain fatty acid omega-hydroxylase activity

fatty acid omega-1 hydroxylase activity [inference]

long-chain fatty acid omega-1 hydroxylase activity

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [inference]

arachidonate monooxygenase activity

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen [inference]

fatty acid omega-hydroxylase activity [inference]

long-chain fatty acid omega-hydroxylase activity

fatty acid omega-1 hydroxylase activity [inference]

long-chain fatty acid omega-1 hydroxylase activity

lyase activity [inference]

carbon-oxygen lyase activity [inference]

hydro-lyase activity [inference]

hydroperoxy icosatetraenoate dehydratase activity

binding [inference]

protein binding [inference]

heat shock protein binding [inference]

protein-folding chaperone binding [inference]

Hsp70 protein binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

iron ion binding

tetrapyrrole binding [inference]

heme binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSTSAMELLLTATIFCLVLWVVRIFRPQVPKGLKSPPGPWGWPLIGHMLTLGKNPHLALTRLSARYGDVLQIRIGSTPVVVLSGLDTIRQALVRQGDDFKGRPDLYSFTFISDGQSMTFNPDSGPVWAARRRLAQSALKSFSVASDPASVSSCYLEEHVKKEAEYLIKKFQELMAGPGHFDPYRYVVVSVANVISAICFGQRYSHDDQQLLELIDLNNEFGEVTGSGNPSDFIPILRYLPSATMDTFKDLNRRFSVFIQKMIKEHYKTFEKGHIRDITDSLIEHCQDRKLDKNANIQISDQKIIGIVLDLFGAGFDTITTAISWSLLYLVMNPRIQKKIQEELDTVIGRERQPQLADRPKLPYMEAFISEVFRYSSFMPFTIPHSTTKDTSLNGFYIPKGCCIFVNQWQINHDQKLWGDPSVFRPERFLSPDGTVDKALSEKVTIFGLGKRRCLGEVIGRWEVFLFLAILLQQLEFSTSPGVKIDMTPIYGLTMKYSRCEHFQAQTRPFVLKCPEA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
63	O-linked (GlcNAc) serine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements