GlyCosmos Portal

Submissions

Polypeptide N-acetylgalactosaminyltransferase 1

Summary

UniProt ID: Q07537
Gene Symbol: GALNT1
Gene ID: 282241
Organism: Bos taurus (domestic cattle)

External Links

Re-Glyco: Q07537

Annotation

Keyword: Direct protein sequencing Disulfide bond Glycoprotein Glycosyltransferase Golgi apparatus Lectin Manganese Metal-binding Reference proteome Secreted Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying **all 2** entries
GO Term	Evidence Code	Reference
protein O-linked glycosylation	IDA	PMID PMID
protein O-linked glycosylation	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation

primary metabolic process [inference]

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation

carbohydrate derivative metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein O-linked glycosylation

Displaying **all 5** entries
GO Term	Evidence Code	Reference
extracellular region	IEA	GO_REF
Golgi apparatus	IBA	GO_REF
Golgi apparatus	IEA	GO_REF
Golgi cisterna membrane	IEA	GO_REF
perinuclear region of cytoplasm	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

membrane [inference]

organelle membrane [inference]

Golgi cisterna membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

perinuclear region of cytoplasm

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
polypeptide N-acetylgalactosaminyltransferase activity	IDA	PMID PMID PMID PMID
polypeptide N-acetylgalactosaminyltransferase activity	IBA	GO_REF
polypeptide N-acetylgalactosaminyltransferase activity	IEA	GO_REF GO_REF GO_REF
manganese ion binding	IDA	PMID
manganese ion binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

UDP-glycosyltransferase activity [inference]

acetylgalactosaminyltransferase activity [inference]

polypeptide N-acetylgalactosaminyltransferase activity

hexosyltransferase activity [inference]

acetylgalactosaminyltransferase activity [inference]

polypeptide N-acetylgalactosaminyltransferase activity

catalytic activity, acting on a protein [inference]

polypeptide N-acetylgalactosaminyltransferase activity

binding [inference]

carbohydrate binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

manganese ion binding

Gene Ontology information from UniProt.

Site Annotations

Displaying 1 entry
Position	Description
141	Not glycosylated

Annotation information from UniProt.

Sequence

MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMLEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRHKLQCRPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATDEDSQVPSIRDCSGSRSQQWLLRNVTLPEIF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
95	N-linked (GlcNAc...) asparagine	3082881		UniProt
552	N-linked (GlcNAc...) asparagine	3082881		UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
COPI-independent Golgi-to-ER retrograde traffic	Bos taurus
O-linked glycosylation of mucins	Bos taurus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements