GlyCosmos Portal

Submissions

Apoptosis regulator BAX

Summary

UniProt ID: Q07813
Gene Symbol: Bax
Gene ID: 12028
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q07813
PubChem: Q07813
Re-Glyco: Q07813

Annotation

Keyword: 3D-structure Acetylation Alternative splicing Apoptosis Cytoplasm Host-virus interaction Isopeptide bond Mitochondrion outer membrane Nucleus Reference proteome Transmembrane helix Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of **165** in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
ovarian follicle development	IMP	PMID
ovarian follicle development	IGI	PMID
ovarian follicle development	IEA	GO_REF
neuron migration	IMP	PMID
leukocyte homeostasis	IGI	PMID PMID

GO Hierarchy

biological process

immune system process [inference]

leukocyte homeostasis

lymphocyte homeostasis [inference]

B cell homeostasis

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

B cell receptor signaling pathway [inference]

B cell receptor apoptotic signaling pathway

myeloid cell homeostasis

B cell selection [inference]

B cell negative selection

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

T cell proliferation [inference]

T cell homeostatic proliferation

B cell activation [inference]

B cell proliferation [inference]

B cell homeostatic proliferation

lymphocyte proliferation [inference]

T cell proliferation [inference]

T cell homeostatic proliferation

B cell proliferation [inference]

B cell homeostatic proliferation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

T cell proliferation [inference]

T cell homeostatic proliferation

B cell activation [inference]

B cell proliferation [inference]

B cell homeostatic proliferation

lymphocyte proliferation [inference]

T cell proliferation [inference]

T cell homeostatic proliferation

B cell proliferation [inference]

B cell homeostatic proliferation

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

B cell receptor signaling pathway [inference]

B cell receptor apoptotic signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

B cell receptor signaling pathway [inference]

B cell receptor apoptotic signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

B cell receptor signaling pathway [inference]

B cell receptor apoptotic signaling pathway

extrinsic apoptotic signaling pathway

intracellular signal transduction [inference]

signal transduction by p53 class mediator [inference]

intrinsic apoptotic signaling pathway by p53 class mediator

intrinsic apoptotic signaling pathway

signal transduction in absence of ligand [inference]

extrinsic apoptotic signaling pathway in absence of ligand

apoptotic signaling pathway

extrinsic apoptotic signaling pathway

intrinsic apoptotic signaling pathway

metabolic process [inference]

primary metabolic process [inference]

lipid metabolic process [inference]

sphingolipid metabolic process [inference]

glycosphingolipid metabolic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process

carbohydrate derivative metabolic process [inference]

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process

cell death [inference]

programmed cell death [inference]

apoptotic process

neuron apoptotic process

leukocyte apoptotic process [inference]

lymphocyte apoptotic process [inference]

B cell apoptotic process

T cell apoptotic process [inference]

thymocyte apoptotic process

apoptotic process involved in development [inference]

apoptotic process involved in morphogenesis [inference]

programmed cell death involved in cell development [inference]

cell population proliferation

epithelial cell proliferation [inference]

Sertoli cell proliferation

leukocyte proliferation [inference]

mononuclear cell proliferation [inference]

lymphocyte proliferation [inference]

T cell proliferation [inference]

T cell homeostatic proliferation

B cell proliferation [inference]

B cell homeostatic proliferation

cellular process involved in reproduction in multicellular organism [inference]

cellular developmental process [inference]

programmed cell death involved in cell development [inference]

cell differentiation [inference]

spermatid differentiation

cell development [inference]

germ cell development

cell motility [inference]

cell migration [inference]

neuron migration

cellular localization [inference]

localization within membrane [inference]

establishment of protein localization to membrane [inference]

protein insertion into membrane [inference]

protein insertion into mitochondrial membrane

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to DNA damage stimulus

intrinsic apoptotic signaling pathway in response to DNA damage

response to endoplasmic reticulum stress [inference]

intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

establishment or maintenance of transmembrane electrochemical gradient

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

mitochondrion organization

mitochondrial membrane organization [inference]

protein insertion into mitochondrial membrane

mitochondrial fusion

apoptotic mitochondrial changes

regulation of mitochondrial membrane permeability involved in apoptotic process

positive regulation of mitochondrial membrane permeability involved in apoptotic process

organelle fusion [inference]

mitochondrial fusion

membrane organization [inference]

mitochondrial membrane organization [inference]

protein insertion into mitochondrial membrane

supramolecular fiber organization

execution phase of apoptosis

reproductive process [inference]

developmental process involved in reproduction [inference]

reproductive structure development [inference]

gonad development [inference]

male gonad development

genitalia development [inference]

female genitalia development [inference]

vagina development

fertilization

multicellular organismal reproductive process [inference]

gamete generation [inference]

male gamete generation [inference]

spermatogenesis

cellular process involved in reproduction in multicellular organism [inference]

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation [inference]

T cell proliferation [inference]

T cell homeostatic proliferation

B cell activation [inference]

B cell proliferation [inference]

B cell homeostatic proliferation

lymphocyte proliferation [inference]

T cell proliferation [inference]

T cell homeostatic proliferation

B cell proliferation [inference]

B cell homeostatic proliferation

post-embryonic development

tissue remodeling [inference]

blood vessel remodeling

multicellular organismal-level homeostasis [inference]

homeostasis of number of cells

leukocyte homeostasis

lymphocyte homeostasis [inference]

B cell homeostasis

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

homeostasis of number of cells within a tissue

developmental process [inference]

developmental process involved in reproduction [inference]

reproductive structure development [inference]

gonad development [inference]

male gonad development

genitalia development [inference]

female genitalia development [inference]

vagina development

anatomical structure morphogenesis [inference]

animal organ morphogenesis [inference]

odontogenesis [inference]

odontogenesis of dentin-containing tooth

sensory organ morphogenesis [inference]

eye morphogenesis [inference]

post-embryonic eye morphogenesis [inference]

post-embryonic camera-type eye morphogenesis

appendage morphogenesis [inference]

limb morphogenesis

anatomical structure development [inference]

cell development [inference]

germ cell development

animal organ development [inference]

kidney development

gonad development [inference]

male gonad development

genitalia development [inference]

female genitalia development [inference]

vagina development

reproductive structure development [inference]

gonad development [inference]

male gonad development

genitalia development [inference]

female genitalia development [inference]

vagina development

system development [inference]

nervous system development

retina development in camera-type eye

cellular developmental process [inference]

programmed cell death involved in cell development [inference]

cell differentiation [inference]

spermatid differentiation

cell development [inference]

germ cell development

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis [inference]

endoplasmic reticulum calcium ion homeostasis [inference]

negative regulation of endoplasmic reticulum calcium ion concentration

multicellular organismal-level homeostasis [inference]

homeostasis of number of cells

leukocyte homeostasis

lymphocyte homeostasis [inference]

B cell homeostasis

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

homeostasis of number of cells within a tissue

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis [inference]

endoplasmic reticulum calcium ion homeostasis [inference]

negative regulation of endoplasmic reticulum calcium ion concentration

monoatomic cation homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis [inference]

endoplasmic reticulum calcium ion homeostasis [inference]

negative regulation of endoplasmic reticulum calcium ion concentration

calcium ion homeostasis [inference]

intracellular calcium ion homeostasis [inference]

endoplasmic reticulum calcium ion homeostasis [inference]

negative regulation of endoplasmic reticulum calcium ion concentration

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis [inference]

endoplasmic reticulum calcium ion homeostasis [inference]

negative regulation of endoplasmic reticulum calcium ion concentration

inorganic ion homeostasis [inference]

calcium ion homeostasis [inference]

intracellular calcium ion homeostasis [inference]

endoplasmic reticulum calcium ion homeostasis [inference]

negative regulation of endoplasmic reticulum calcium ion concentration

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to virus [inference]

cellular response to virus

response to stimulus [inference]

response to stress [inference]

response to osmotic stress [inference]

response to salt stress

response to wounding

response to axon injury

cellular response to stress [inference]

cellular response to DNA damage stimulus

intrinsic apoptotic signaling pathway in response to DNA damage

response to endoplasmic reticulum stress [inference]

intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus [inference]

cellular response to virus

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus [inference]

cellular response to virus

response to abiotic stimulus [inference]

response to osmotic stress [inference]

response to salt stress

response to radiation [inference]

response to light stimulus [inference]

response to UV [inference]

cellular response to UV

cellular response to light stimulus [inference]

cellular response to UV

response to ionizing radiation

response to gamma radiation

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV

response to chemical [inference]

response to toxic substance

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to DNA damage stimulus

intrinsic apoptotic signaling pathway in response to DNA damage

response to endoplasmic reticulum stress [inference]

intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic ion transmembrane transport [inference]

establishment or maintenance of transmembrane electrochemical gradient

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

establishment or maintenance of transmembrane electrochemical gradient

establishment of protein localization [inference]

establishment of protein localization to organelle [inference]

protein insertion into mitochondrial membrane

establishment of protein localization to membrane [inference]

protein insertion into membrane [inference]

protein insertion into mitochondrial membrane

establishment of localization in cell [inference]

protein insertion into mitochondrial membrane

cellular localization [inference]

localization within membrane [inference]

establishment of protein localization to membrane [inference]

protein insertion into membrane [inference]

protein insertion into mitochondrial membrane

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

B cell receptor signaling pathway [inference]

B cell receptor apoptotic signaling pathway

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

B cell receptor signaling pathway [inference]

B cell receptor apoptotic signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

B cell receptor signaling pathway [inference]

B cell receptor apoptotic signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

B cell receptor signaling pathway [inference]

B cell receptor apoptotic signaling pathway

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of intrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway

regulation of localization [inference]

regulation of transport [inference]

regulation of transmembrane transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

regulation of monoatomic ion transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of calcium ion transport into cytosol [inference]

positive regulation of calcium ion transport into cytosol

regulation of release of sequestered calcium ion into cytosol [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

regulation of monoatomic ion transport [inference]

regulation of metal ion transport [inference]

regulation of calcium ion transport [inference]

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of calcium ion transport into cytosol [inference]

positive regulation of calcium ion transport into cytosol

regulation of release of sequestered calcium ion into cytosol [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of calcium ion transmembrane transport [inference]

regulation of monoatomic ion transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of calcium ion transport into cytosol [inference]

positive regulation of calcium ion transport into cytosol

regulation of release of sequestered calcium ion into cytosol [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of monoatomic ion transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of monoatomic ion transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

regulation of cellular localization [inference]

regulation of calcium ion transport into cytosol [inference]

positive regulation of calcium ion transport into cytosol

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

B cell receptor signaling pathway [inference]

B cell receptor apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of developmental pigmentation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of DNA catabolic process [inference]

positive regulation of apoptotic DNA fragmentation

positive regulation of macromolecule metabolic process [inference]

positive regulation of DNA metabolic process [inference]

positive regulation of DNA catabolic process [inference]

positive regulation of apoptotic DNA fragmentation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of neuron apoptotic process

positive regulation of apoptotic process involved in development [inference]

positive regulation of apoptotic process involved in morphogenesis [inference]

positive regulation of apoptotic process involved in mammary gland involution

positive regulation of leukocyte apoptotic process [inference]

positive regulation of lymphocyte apoptotic process [inference]

positive regulation of B cell apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of release of cytochrome c from mitochondria

positive regulation of protein-containing complex assembly

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

B cell receptor signaling pathway [inference]

B cell receptor apoptotic signaling pathway

positive regulation of transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of monoatomic ion transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of calcium ion transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of developmental process [inference]

positive regulation of apoptotic process involved in development [inference]

positive regulation of apoptotic process involved in morphogenesis [inference]

positive regulation of apoptotic process involved in mammary gland involution

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of fibroblast proliferation

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of intrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of response to nutrient levels [inference]

regulation of nitrogen utilization

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

B cell receptor signaling pathway [inference]

B cell receptor apoptotic signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

B cell receptor signaling pathway [inference]

B cell receptor apoptotic signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

B cell receptor signaling pathway [inference]

B cell receptor apoptotic signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

B cell receptor signaling pathway [inference]

B cell receptor apoptotic signaling pathway

regulation of developmental process [inference]

positive regulation of developmental process [inference]

positive regulation of apoptotic process involved in development [inference]

positive regulation of apoptotic process involved in morphogenesis [inference]

positive regulation of apoptotic process involved in mammary gland involution

regulation of apoptotic process involved in development [inference]

positive regulation of apoptotic process involved in development [inference]

positive regulation of apoptotic process involved in morphogenesis [inference]

positive regulation of apoptotic process involved in mammary gland involution

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

B cell receptor signaling pathway [inference]

B cell receptor apoptotic signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

B cell receptor signaling pathway [inference]

B cell receptor apoptotic signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

B cell receptor signaling pathway [inference]

B cell receptor apoptotic signaling pathway

extrinsic apoptotic signaling pathway

intracellular signal transduction [inference]

signal transduction by p53 class mediator [inference]

intrinsic apoptotic signaling pathway by p53 class mediator

intrinsic apoptotic signaling pathway

signal transduction in absence of ligand [inference]

extrinsic apoptotic signaling pathway in absence of ligand

apoptotic signaling pathway

extrinsic apoptotic signaling pathway

intrinsic apoptotic signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of intrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway

regulation of metabolic process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of DNA catabolic process [inference]

positive regulation of apoptotic DNA fragmentation

positive regulation of macromolecule metabolic process [inference]

positive regulation of DNA metabolic process [inference]

positive regulation of DNA catabolic process [inference]

positive regulation of apoptotic DNA fragmentation

regulation of catabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of DNA catabolic process [inference]

positive regulation of apoptotic DNA fragmentation

regulation of DNA catabolic process [inference]

regulation of apoptotic DNA fragmentation [inference]

positive regulation of apoptotic DNA fragmentation

positive regulation of DNA catabolic process [inference]

positive regulation of apoptotic DNA fragmentation

regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of DNA metabolic process [inference]

positive regulation of DNA catabolic process [inference]

positive regulation of apoptotic DNA fragmentation

regulation of DNA metabolic process [inference]

positive regulation of DNA metabolic process [inference]

positive regulation of DNA catabolic process [inference]

positive regulation of apoptotic DNA fragmentation

regulation of DNA catabolic process [inference]

regulation of apoptotic DNA fragmentation [inference]

positive regulation of apoptotic DNA fragmentation

positive regulation of DNA catabolic process [inference]

positive regulation of apoptotic DNA fragmentation

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of DNA metabolic process [inference]

positive regulation of DNA metabolic process [inference]

positive regulation of DNA catabolic process [inference]

positive regulation of apoptotic DNA fragmentation

regulation of DNA catabolic process [inference]

regulation of apoptotic DNA fragmentation [inference]

positive regulation of apoptotic DNA fragmentation

positive regulation of DNA catabolic process [inference]

positive regulation of apoptotic DNA fragmentation

regulation of transmembrane transport [inference]

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

regulation of monoatomic ion transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of calcium ion transport into cytosol [inference]

positive regulation of calcium ion transport into cytosol

regulation of release of sequestered calcium ion into cytosol [inference]

positive regulation of release of sequestered calcium ion into cytosol

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation

negative regulation of fibroblast proliferation

regulation of fibroblast proliferation [inference]

negative regulation of fibroblast proliferation

regulation of epithelial cell proliferation [inference]

regulation of mammary gland epithelial cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process

positive regulation of apoptotic process

positive regulation of neuron apoptotic process

positive regulation of apoptotic process involved in development [inference]

positive regulation of apoptotic process involved in morphogenesis [inference]

positive regulation of apoptotic process involved in mammary gland involution

positive regulation of leukocyte apoptotic process [inference]

positive regulation of lymphocyte apoptotic process [inference]

positive regulation of B cell apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic process [inference]

regulation of neuron apoptotic process

regulation of apoptotic process involved in development [inference]

positive regulation of apoptotic process involved in development [inference]

positive regulation of apoptotic process involved in morphogenesis [inference]

positive regulation of apoptotic process involved in mammary gland involution

regulation of leukocyte apoptotic process [inference]

regulation of lymphocyte apoptotic process [inference]

regulation of B cell apoptotic process [inference]

positive regulation of B cell apoptotic process

positive regulation of lymphocyte apoptotic process [inference]

positive regulation of B cell apoptotic process

positive regulation of leukocyte apoptotic process [inference]

positive regulation of lymphocyte apoptotic process [inference]

positive regulation of B cell apoptotic process

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of intrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of extrinsic apoptotic signaling pathway in absence of ligand [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of neuron apoptotic process

positive regulation of apoptotic process involved in development [inference]

positive regulation of apoptotic process involved in morphogenesis [inference]

positive regulation of apoptotic process involved in mammary gland involution

positive regulation of leukocyte apoptotic process [inference]

positive regulation of lymphocyte apoptotic process [inference]

positive regulation of B cell apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

regulation of cellular component biogenesis [inference]

regulation of protein-containing complex assembly [inference]

positive regulation of protein-containing complex assembly

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of DNA catabolic process [inference]

positive regulation of apoptotic DNA fragmentation

positive regulation of macromolecule metabolic process [inference]

positive regulation of DNA metabolic process [inference]

positive regulation of DNA catabolic process [inference]

positive regulation of apoptotic DNA fragmentation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of transmembrane transport [inference]

positive regulation of monoatomic ion transmembrane transport [inference]

positive regulation of cation transmembrane transport [inference]

positive regulation of calcium ion transmembrane transport [inference]

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of neuron apoptotic process

positive regulation of apoptotic process involved in development [inference]

positive regulation of apoptotic process involved in morphogenesis [inference]

positive regulation of apoptotic process involved in mammary gland involution

positive regulation of leukocyte apoptotic process [inference]

positive regulation of lymphocyte apoptotic process [inference]

positive regulation of B cell apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway in absence of ligand

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of release of cytochrome c from mitochondria

positive regulation of protein-containing complex assembly

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of fibroblast proliferation

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of release of cytochrome c from mitochondria

regulation of mitochondrion organization [inference]

regulation of release of cytochrome c from mitochondria [inference]

positive regulation of release of cytochrome c from mitochondria

regulation of protein-containing complex assembly [inference]

positive regulation of protein-containing complex assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of release of cytochrome c from mitochondria

positive regulation of protein-containing complex assembly

regulation of cell cycle

regulation of cellular localization [inference]

regulation of calcium ion transport into cytosol [inference]

positive regulation of calcium ion transport into cytosol

regulation of pigmentation [inference]

regulation of developmental pigmentation [inference]

positive regulation of developmental pigmentation

regulation of biological quality [inference]

positive regulation of cytosolic calcium ion concentration [inference]

positive regulation of calcium ion transport into cytosol

regulation of calcium ion transport into cytosol [inference]

positive regulation of calcium ion transport into cytosol

regulation of membrane potential [inference]

negative regulation of membrane potential [inference]

negative regulation of mitochondrial membrane potential

regulation of mitochondrial membrane potential

negative regulation of mitochondrial membrane potential

regulation of membrane permeability [inference]

regulation of mitochondrial membrane permeability [inference]

positive regulation of mitochondrial membrane permeability [inference]

mitochondrial outer membrane permeabilization involved in programmed cell death [inference]

positive regulation of mitochondrial membrane permeability involved in apoptotic process

regulation of mitochondrial membrane permeability involved in apoptotic process

positive regulation of mitochondrial membrane permeability involved in apoptotic process

regulation of mitochondrial membrane permeability involved in programmed necrotic cell death

positive regulation of membrane permeability [inference]

positive regulation of mitochondrial membrane permeability [inference]

mitochondrial outer membrane permeabilization involved in programmed cell death [inference]

positive regulation of mitochondrial membrane permeability involved in apoptotic process

Displaying entries **1 - 5** of 47 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISS	GO_REF
nucleus	ISO	GO_REF
nucleus	IEA	GO_REF GO_REF
nuclear envelope	ISO	GO_REF
nuclear envelope	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

Bcl-2 family protein complex

membrane protein complex [inference]

pore complex

mitochondrial permeability transition pore complex

mitochondrial protein-containing complex [inference]

mitochondrial permeability transition pore complex

cellular anatomical structure [inference]

membrane

plasma membrane

outer membrane [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

organelle membrane [inference]

endoplasmic reticulum membrane

mitochondrial membrane

mitochondrial outer membrane

bounding membrane of organelle [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

organelle envelope [inference]

nuclear envelope

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

perinuclear region of cytoplasm

Displaying entries **1 - 5** of 24 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
lipid binding	ISS	GO_REF
lipid binding	ISO	GO_REF
lipid binding	IEA	GO_REF
channel activity	ISS	GO_REF
channel activity	ISO	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

passive transmembrane transporter activity [inference]

channel activity

binding [inference]

protein binding [inference]

protein domain specific binding [inference]

BH domain binding

BH3 domain binding

death domain binding [inference]

BH3 domain binding

heat shock protein binding

Hsp70 protein binding

identical protein binding

protein homodimerization activity

protein dimerization activity [inference]

protein-folding chaperone binding

Hsp70 protein binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWEGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
14				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Activation, translocation and oligomerization of BAX	Mus musculus
Pyroptosis	Mus musculus
Release of apoptotic factors from the mitochondria	Mus musculus
TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements