GlyCosmos Portal

Submissions

Calponin-2

Summary

UniProt ID: Q08093
Gene Symbol: Cnn2
Gene ID: 12798
Organism: Mus musculus (house mouse)

External Links

PubChem: Q08093
The O-GlcNAc Database: Q08093
RaftProt: Q08093
Re-Glyco: Q08093

Annotation

Keyword: Acetylation Actin-binding Calmodulin-binding Phosphoprotein Reference proteome Repeat

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
actin filament organization	IBA	GO_REF
positive regulation of gene expression	IMP	PMID
hemopoiesis	IMP	PMID
negative regulation of cell migration	IMP	PMID
actomyosin structure organization	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

actin filament-based process [inference]

actin cytoskeleton organization [inference]

actomyosin structure organization

cellular developmental process [inference]

cell development [inference]

hemopoiesis

cellular response to stimulus [inference]

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to mechanical stimulus

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

actin cytoskeleton organization [inference]

actomyosin structure organization

supramolecular fiber organization [inference]

actin filament organization

developmental process [inference]

anatomical structure development [inference]

cell development [inference]

hemopoiesis

cellular developmental process [inference]

cell development [inference]

hemopoiesis

response to stimulus [inference]

response to stress [inference]

response to wounding [inference]

wound healing

response to external stimulus [inference]

response to mechanical stimulus [inference]

cellular response to mechanical stimulus

cellular response to external stimulus [inference]

cellular response to mechanical stimulus

response to abiotic stimulus [inference]

response to mechanical stimulus [inference]

cellular response to mechanical stimulus

cellular response to abiotic stimulus [inference]

cellular response to mechanical stimulus

cellular response to stimulus [inference]

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to mechanical stimulus

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

negative regulation of transport [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

regulation of phagocytosis [inference]

negative regulation of phagocytosis

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

negative regulation of biological process [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of cellular process [inference]

negative regulation of cellular component organization [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of transport [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

negative regulation of cellular process [inference]

negative regulation of cellular component organization [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cellular component organization [inference]

regulation of endocytosis [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

regulation of phagocytosis [inference]

negative regulation of phagocytosis

negative regulation of cellular component organization [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

regulation of phagocytosis [inference]

negative regulation of phagocytosis

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

Displaying **all 3** entries
GO Term	Evidence Code	Reference
stress fiber	ISO	PMID
stress fiber	IEA	GO_REF
actin cytoskeleton	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

actin filament bundle [inference]

contractile actin filament bundle [inference]

stress fiber

actomyosin [inference]

stress fiber

organelle [inference]

membraneless organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton [inference]

actin cytoskeleton

intracellular organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton [inference]

actin cytoskeleton

Displaying **all 2** entries
GO Term	Evidence Code	Reference
calmodulin binding
actin filament binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

calmodulin binding

cytoskeletal protein binding [inference]

actin binding [inference]

actin filament binding

protein-containing complex binding [inference]

actin filament binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRSWIEGLTGLSIGPDFQKGLKDGVILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHCTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGSAADGAPAGDGQGEAPEYLAYCQEEAGY

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites