GlyCosmos Portal

Submissions

2-hydroxyacylsphingosine 1-beta-galactosyltransferase

Summary

UniProt ID: Q09426
Gene Symbol: Cgt Ugt4 Ugt8
Gene ID: 50555
Organism: Rattus norvegicus (Norway rat)

External Links

GlyGen

Q09426

PubChem

Q09426

SwissLipids

SLP:000000910

Re-Glyco

Q09426

Annotation

Keyword: Endoplasmic reticulum Glycoprotein Glycosyltransferase Reference proteome Signal Sphingolipid metabolism Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
protein localization to paranode region of axon	ISO	GO_REF
protein localization to paranode region of axon	IEA	GO_REF
galactosylceramide biosynthetic process	IDA	PMID
galactosylceramide biosynthetic process	IBA	GO_REF
galactosylceramide biosynthetic process	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

ensheathment of neurons [inference]

axon ensheathment [inference]

myelination

metabolic process [inference]

biosynthetic process [inference]

lipid biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

galactosylceramide biosynthetic process

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

galactosylceramide biosynthetic process

ceramide biosynthetic process [inference]

galactosylceramide biosynthetic process

carbohydrate derivative biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

galactosylceramide biosynthetic process

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

primary metabolic process [inference]

lipid metabolic process [inference]

sphingolipid metabolic process [inference]

ceramide metabolic process [inference]

glycosylceramide metabolic process [inference]

galactosylceramide metabolic process [inference]

galactosylceramide biosynthetic process

ceramide biosynthetic process [inference]

galactosylceramide biosynthetic process

glycosphingolipid metabolic process [inference]

glycosylceramide metabolic process [inference]

galactosylceramide metabolic process [inference]

galactosylceramide biosynthetic process

glycosphingolipid biosynthetic process

galactosylceramide biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

galactosylceramide biosynthetic process

ceramide biosynthetic process [inference]

galactosylceramide biosynthetic process

lipid biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

galactosylceramide biosynthetic process

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

galactosylceramide biosynthetic process

ceramide biosynthetic process [inference]

galactosylceramide biosynthetic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

glycosylceramide metabolic process [inference]

galactosylceramide metabolic process [inference]

galactosylceramide biosynthetic process

glycosphingolipid biosynthetic process

galactosylceramide biosynthetic process

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

galactosylceramide biosynthetic process

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

galactolipid metabolic process [inference]

galactosylceramide metabolic process [inference]

galactosylceramide biosynthetic process

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

carbohydrate derivative metabolic process [inference]

carbohydrate derivative biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

galactosylceramide biosynthetic process

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

glycosylceramide metabolic process [inference]

galactosylceramide metabolic process [inference]

galactosylceramide biosynthetic process

glycosphingolipid biosynthetic process

galactosylceramide biosynthetic process

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

galactosylceramide biosynthetic process

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

galactolipid metabolic process [inference]

galactosylceramide metabolic process [inference]

galactosylceramide biosynthetic process

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization

cellular component assembly [inference]

cellular component assembly involved in morphogenesis [inference]

paranodal junction assembly

cell junction assembly [inference]

cell-cell junction assembly [inference]

paranodal junction assembly

cell projection organization [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis

cell junction organization [inference]

cell junction assembly [inference]

cell-cell junction assembly [inference]

paranodal junction assembly

cell-cell junction organization [inference]

cell-cell junction assembly [inference]

paranodal junction assembly

developmental process [inference]

anatomical structure morphogenesis [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis

anatomical structure formation involved in morphogenesis [inference]

cellular component assembly involved in morphogenesis [inference]

paranodal junction assembly

response to stimulus [inference]

response to stress [inference]

response to immobilization stress

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein localization to axon [inference]

protein localization to paranode region of axon

Displaying **all 4** entries
GO Term	Evidence Code	Reference
endoplasmic reticulum	IDA	PMID
endoplasmic reticulum	IBA	GO_REF
endoplasmic reticulum	IEA	GO_REF
membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

Displaying **all 5** entries
GO Term	Evidence Code	Reference
N-acylsphingosine galactosyltransferase activity	EXP	PMID
N-acylsphingosine galactosyltransferase activity	IDA	PMID
N-acylsphingosine galactosyltransferase activity	IBA	GO_REF
N-acylsphingosine galactosyltransferase activity	IEA	GO_REF GO_REF
UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity	IMP	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

UDP-glycosyltransferase activity [inference]

UDP-galactosyltransferase activity [inference]

hexosyltransferase activity [inference]

galactosyltransferase activity [inference]

UDP-galactosyltransferase activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKSYTPYFMLLWSAVGIARAAKIIIVPPIMFESHLYIFKTLASALHERGHHTVFLLSEGRDIDPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAVELVDILDHYTKNCDMMVGNQALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEFNSLLTDRMNFLERMKNTGVYLISRMGVSFLVLPKYERIMQKYNLLPAKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASPLPEDLQRWVDGAQEHGFVLVSFGAGVKYLSEDIANKLAGALGRLPQKVIWRFSGTKPKNLGNNTKLIEWLPQNDLLGHSNIRAFLSHGGLNSIFETMYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWNTVTEGELYDALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTTYWIDYILRHDGAHHLRSAVHQISFCQYFLLDIAFVLLLGAVALYFIVSYVTKFIYRKVKSLCSRSTHSTVNGHYQNGILNGRYKGNGHIKHEKKVK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	PubMed ID	Source
78	N-linked (GlcNAc...) asparagine	7694285	UniProt GlyGen
333	N-linked (GlcNAc...) asparagine	7694285	UniProt GlyGen
442	N-linked (GlcNAc...) asparagine		UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Glycosphingolipid biosynthesis	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements