GlyCosmos Portal

Submissions

Serine/threonine-protein kinase receptor sma-6

Summary

UniProt ID: Q09488
Gene Symbol: C32D5.2 sma-6
Gene ID: 174044
Organism: Caenorhabditis elegans

External Links

Re-Glyco: Q09488

Annotation

Keyword: ATP-binding Developmental protein Glycoprotein Receptor Reference proteome Serine/threonine-protein kinase Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
nervous system development	IBA	GO_REF
regulation of cell morphogenesis	IMP	PMID
regulation of cell adhesion	IMP	PMID
BMP signaling pathway	ISS	PMID
positive regulation of transforming growth factor beta receptor signaling pathway	IGI	PMID

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

innate immune response

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

maintenance of location in cell [inference]

maintenance of protein location in cell [inference]

maintenance of protein localization in organelle [inference]

maintenance of protein location in nucleus

multicellular organismal process [inference]

multicellular organism development [inference]

larval development [inference]

nematode larval development [inference]

dauer larval development

post-embryonic development [inference]

larval development [inference]

nematode larval development [inference]

dauer larval development

developmental process [inference]

anatomical structure morphogenesis [inference]

male anatomical structure morphogenesis [inference]

nematode male tail tip morphogenesis

anatomical structure development [inference]

multicellular organism development [inference]

larval development [inference]

nematode larval development [inference]

dauer larval development

system development [inference]

nervous system development

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to Gram-positive bacterium

response to fungus [inference]

defense response to fungus

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to bacterium [inference]

defense response to Gram-positive bacterium

defense response to fungus

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

immune response [inference]

innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to Gram-positive bacterium

response to fungus [inference]

defense response to fungus

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to Gram-positive bacterium

response to fungus [inference]

defense response to fungus

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to endogenous stimulus [inference]

response to growth factor [inference]

cellular response to growth factor stimulus

cellular response to endogenous stimulus [inference]

cellular response to growth factor stimulus

localization [inference]

maintenance of location [inference]

maintenance of protein location [inference]

maintenance of protein location in cell [inference]

maintenance of protein localization in organelle [inference]

maintenance of protein location in nucleus

maintenance of location in cell [inference]

maintenance of protein location in cell [inference]

maintenance of protein localization in organelle [inference]

maintenance of protein location in nucleus

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of transforming growth factor beta receptor signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

regulation of growth [inference]

positive regulation of growth [inference]

positive regulation of developmental growth [inference]

positive regulation of multicellular organism growth

regulation of developmental growth [inference]

regulation of multicellular organism growth [inference]

positive regulation of multicellular organism growth

positive regulation of developmental growth [inference]

positive regulation of multicellular organism growth

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

positive regulation of growth [inference]

positive regulation of developmental growth [inference]

positive regulation of multicellular organism growth

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

positive regulation of cellular response to transforming growth factor beta stimulus [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

positive regulation of developmental process [inference]

positive regulation of developmental growth [inference]

positive regulation of multicellular organism growth

positive regulation of multicellular organismal process [inference]

positive regulation of multicellular organism growth

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of transforming growth factor beta receptor signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

positive regulation of cellular response to transforming growth factor beta stimulus [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

regulation of cellular response to growth factor stimulus [inference]

regulation of cellular response to transforming growth factor beta stimulus [inference]

regulation of transforming growth factor beta receptor signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

positive regulation of cellular response to transforming growth factor beta stimulus [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of cell morphogenesis

regulation of developmental growth [inference]

regulation of multicellular organism growth [inference]

positive regulation of multicellular organism growth

positive regulation of developmental growth [inference]

positive regulation of multicellular organism growth

positive regulation of developmental process [inference]

positive regulation of developmental growth [inference]

positive regulation of multicellular organism growth

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of transforming growth factor beta receptor signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of catabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of protein metabolic process [inference]

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of protein metabolic process [inference]

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

regulation of cell adhesion

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of transforming growth factor beta receptor signaling pathway

regulation of multicellular organismal process [inference]

regulation of multicellular organism growth [inference]

positive regulation of multicellular organism growth

positive regulation of multicellular organismal process [inference]

positive regulation of multicellular organism growth

Displaying **all 4** entries
GO Term	Evidence Code	Reference
nucleus	IEA	GO_REF
plasma membrane	ISS	PMID
plasma membrane	IBA	GO_REF
activin receptor complex	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex [inference]

plasma membrane signaling receptor complex [inference]

activin receptor complex

membrane protein complex [inference]

plasma membrane protein complex [inference]

plasma membrane signaling receptor complex [inference]

activin receptor complex

catalytic complex [inference]

transferase complex [inference]

transferase complex, transferring phosphorus-containing groups [inference]

protein kinase complex [inference]

serine/threonine protein kinase complex [inference]

activin receptor complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying **all 5** entries
GO Term	Evidence Code	Reference
protein serine/threonine kinase activity	ISS	PMID
ATP binding	IEA	GO_REF
activin receptor activity, type I	IBA	GO_REF
BMP binding	IDA	PMID
activin binding	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring phosphorus-containing groups [inference]

kinase activity [inference]

protein kinase activity [inference]

protein serine/threonine kinase activity

transmembrane receptor protein serine/threonine kinase activity [inference]

activin receptor activity [inference]

activin receptor activity, type I

transmembrane receptor protein kinase activity [inference]

transmembrane receptor protein serine/threonine kinase activity [inference]

activin receptor activity [inference]

activin receptor activity, type I

phosphotransferase activity, alcohol group as acceptor [inference]

protein kinase activity [inference]

protein serine/threonine kinase activity

transmembrane receptor protein serine/threonine kinase activity [inference]

activin receptor activity [inference]

activin receptor activity, type I

transmembrane receptor protein kinase activity [inference]

transmembrane receptor protein serine/threonine kinase activity [inference]

activin receptor activity [inference]

activin receptor activity, type I

catalytic activity, acting on a protein [inference]

protein kinase activity [inference]

protein serine/threonine kinase activity

transmembrane receptor protein serine/threonine kinase activity [inference]

activin receptor activity [inference]

activin receptor activity, type I

transmembrane receptor protein kinase activity [inference]

transmembrane receptor protein serine/threonine kinase activity [inference]

activin receptor activity [inference]

activin receptor activity, type I

binding [inference]

protein binding [inference]

cytokine binding [inference]

BMP binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

protein-containing complex binding [inference]

activin binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

transmembrane receptor protein kinase activity [inference]

transmembrane receptor protein serine/threonine kinase activity [inference]

activin receptor activity [inference]

activin receptor activity, type I

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNITFIFILIFGFFNTQKCSKDYDHFDDEDLALSIPKNAIGVPKEFRQQVLKEMKLRNRPNDILKNRCYCNYDQSICGNNMTCVKQDGAACYHAVEEVYNKAEKRMETLHKWGCATLERGSGASHLTCNSWRAAHHSPKSIGCCYEGNYCNKNLIPPAYVHHHKEKALQEKTDNPEDYDSPLENMTRGGKMFIMVFATVMSVFAVIGCIYLCITRAEEKSKARARAKTVSLKTESTYMESKSMLEDSGSGSGQAALIQRTVRQDLTIIKTIGQGRYGEVRKALYRGSYVAVKTFYTTDEDSWKNERDVYQTNMINHENILQFVAADIWSEEDSMTKMLLITDYHELGSLSDYLCREETLTTDEALRLIHSCICGIEHLHAAVHGTGSFRKPEIAHRDIKSKNIIVKRPNVCCIADLGLALRYQNDKILPEKFNVQVGTKRYMAPELISNKLNPKDFSQFKMADIYSMALVMWEVAIRVEVNTCEEVLTVDETSPDHSASSGIGESVSSSGNISRMHLQKTNVEGHSTSLKAKQHVPPFDGIVHNDPNFDEMNDVICVRRIRPPPDLAWKNVPALNELSKLMEDSWHSIPHFRHSALKLKKEMAELIKNPDRQNQSQRKVEFQQQDSGLVESATNQS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
80	N-linked (GlcNAc...) asparagine			UniProt
184	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Downregulation of TGF-beta receptor signaling	Caenorhabditis elegans
TGF-beta receptor signaling activates SMADs	Caenorhabditis elegans

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements