GlyCosmos Portal

Submissions

Peptidyl-prolyl cis-trans isomerase A

Summary

UniProt ID: Q0ZQK7
Gene Symbol: PPIA
Gene ID: 100594480
Organism: Nomascus leucogenys (northern white-cheeked gibbon)

External Links

PubChem: Q0ZQK7
Re-Glyco: Q0ZQK7

Annotation

Keyword: Acetylation Apoptosis Cytoplasm Glycoprotein Isopeptide bond Nucleus Phosphoprotein Reference proteome Rotamase Secreted Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 33 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
protein peptidyl-prolyl isomerization	ISS	GO_REF
negative regulation of protein phosphorylation	ISS	GO_REF
positive regulation of protein phosphorylation	ISS	GO_REF
protein folding	IEA	GO_REF GO_REF
negative regulation of protein kinase activity	ISS	GO_REF

GO Hierarchy

biological process

immune system process [inference]

leukocyte migration [inference]

leukocyte chemotaxis

granulocyte chemotaxis [inference]

neutrophil chemotaxis

myeloid leukocyte migration [inference]

granulocyte migration [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

neutrophil migration [inference]

neutrophil chemotaxis

cellular process [inference]

cell activation [inference]

protein folding

cell adhesion [inference]

cell-cell adhesion [inference]

homotypic cell-cell adhesion [inference]

platelet aggregation

metabolic process [inference]

macromolecule metabolic process [inference]

protein metabolic process [inference]

protein modification process [inference]

peptidyl-amino acid modification [inference]

peptidyl-proline modification [inference]

protein peptidyl-prolyl isomerization

macromolecule modification [inference]

protein modification process [inference]

peptidyl-amino acid modification [inference]

peptidyl-proline modification [inference]

protein peptidyl-prolyl isomerization

primary metabolic process [inference]

protein metabolic process [inference]

protein modification process [inference]

peptidyl-amino acid modification [inference]

peptidyl-proline modification [inference]

protein peptidyl-prolyl isomerization

cell death [inference]

programmed cell death [inference]

apoptotic process

cell motility [inference]

cell migration [inference]

leukocyte migration [inference]

leukocyte chemotaxis

granulocyte chemotaxis [inference]

neutrophil chemotaxis

myeloid leukocyte migration [inference]

granulocyte migration [inference]

granulocyte chemotaxis [inference]

neutrophil chemotaxis

neutrophil migration [inference]

neutrophil chemotaxis

cell chemotaxis [inference]

leukocyte chemotaxis

granulocyte chemotaxis [inference]

neutrophil chemotaxis

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

cell adhesion molecule production

multicellular organismal process [inference]

cell activation [inference]

locomotion [inference]

taxis [inference]

chemotaxis [inference]

cell chemotaxis [inference]

leukocyte chemotaxis

granulocyte chemotaxis [inference]

neutrophil chemotaxis

response to stimulus [inference]

response to stress [inference]

response to oxidative stress [inference]

cellular response to oxidative stress

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

response to chemical [inference]

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

positive regulation of MAPK cascade

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

positive regulation of MAPK cascade

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

regulation of viral process [inference]

regulation of viral life cycle [inference]

regulation of viral genome replication

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

positive regulation of MAPK cascade

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of metabolic process [inference]

negative regulation of metabolic process [inference]

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

positive regulation of metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of phosphorus metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

regulation of phosphorylation [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of kinase activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of post-translational protein modification [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein ubiquitination [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of protein polyubiquitination [inference]

regulation of protein K48-linked ubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of post-translational protein modification [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein ubiquitination [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of protein polyubiquitination [inference]

regulation of protein K48-linked ubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation

negative regulation of protein kinase activity

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein ubiquitination [inference]

negative regulation of protein polyubiquitination [inference]

negative regulation of protein K48-linked ubiquitination

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway

regulation of cellular response to stress [inference]

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade [inference]

negative regulation of stress-activated MAPK cascade

negative regulation of stress-activated protein kinase signaling cascade [inference]

negative regulation of stress-activated MAPK cascade

regulation of molecular function [inference]

negative regulation of molecular function [inference]

negative regulation of catalytic activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of molecular function [inference]

positive regulation of catalytic activity [inference]

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of catalytic activity [inference]

positive regulation of catalytic activity [inference]

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

negative regulation of catalytic activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

regulation of transferase activity [inference]

regulation of kinase activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of kinase activity [inference]

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

positive regulation of protein kinase activity [inference]

activation of protein kinase activity [inference]

activation of protein kinase B activity

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	IEA	GO_REF GO_REF
nucleus	ISS	GO_REF
nucleus	IEA	GO_REF GO_REF
cytoplasm	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
peptidyl-prolyl cis-trans isomerase activity	ISS	GO_REF
peptidyl-prolyl cis-trans isomerase activity	IEA	GO_REF GO_REF GO_REF GO_REF GO_REF GO_REF
integrin binding	ISS	GO_REF
cyclosporin A binding	IEA	GO_REF
heparan sulfate binding	ISS	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

isomerase activity [inference]

cis-trans isomerase activity [inference]

peptidyl-prolyl cis-trans isomerase activity

catalytic activity, acting on a protein [inference]

peptidyl-prolyl cis-trans isomerase activity

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

integrin binding

cell adhesion molecule binding [inference]

integrin binding

cyclosporin A binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

carboxylic acid binding [inference]

heparan sulfate binding

organic acid binding [inference]

carboxylic acid binding [inference]

heparan sulfate binding

protein-containing complex binding [inference]

integrin binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

heparan sulfate binding

sulfur compound binding [inference]

heparan sulfate binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
108	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements