GlyCosmos Portal

Submissions

Galactoside alpha-(1,2)-fucosyltransferase 2

Summary

UniProt ID: Q10981
Gene Symbol: FUT2 SEC2
Gene ID: 2524
Organism: Homo sapiens (human)

External Links

PubChem: Q10981
The Human Metabolome Database: HMDBP00466
Re-Glyco: Q10981

Annotation

Keyword: Blood group antigen Glycoprotein Glycosyltransferase Golgi apparatus Lipid metabolism Proteomics identification Reference proteome Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
carbohydrate metabolic process	TAS	PMID
carbohydrate metabolic process	IEA	GO_REF
glycosphingolipid biosynthetic process	TAS	Reactome
glycoprotein biosynthetic process	ISS	GO_REF
glycoprotein biosynthetic process	TAS	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

carbohydrate catabolic process [inference]

monosaccharide catabolic process [inference]

hexose catabolic process [inference]

L-fucose catabolic process

small molecule catabolic process [inference]

monosaccharide catabolic process [inference]

hexose catabolic process [inference]

L-fucose catabolic process

biosynthetic process [inference]

lipid biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process

carbohydrate biosynthetic process [inference]

oligosaccharide biosynthetic process

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process

primary metabolic process [inference]

carbohydrate metabolic process

monosaccharide metabolic process [inference]

hexose metabolic process [inference]

fucose metabolic process [inference]

L-fucose metabolic process [inference]

L-fucose catabolic process

hexose catabolic process [inference]

L-fucose catabolic process

monosaccharide catabolic process [inference]

hexose catabolic process [inference]

L-fucose catabolic process

oligosaccharide metabolic process [inference]

oligosaccharide biosynthetic process

carbohydrate biosynthetic process [inference]

oligosaccharide biosynthetic process

carbohydrate catabolic process [inference]

monosaccharide catabolic process [inference]

hexose catabolic process [inference]

L-fucose catabolic process

lipid metabolic process [inference]

sphingolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

glycosphingolipid biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

lipid biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

glycosphingolipid biosynthetic process

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process

small molecule metabolic process [inference]

monosaccharide metabolic process [inference]

hexose metabolic process [inference]

fucose metabolic process [inference]

L-fucose metabolic process [inference]

L-fucose catabolic process

hexose catabolic process [inference]

L-fucose catabolic process

monosaccharide catabolic process [inference]

hexose catabolic process [inference]

L-fucose catabolic process

small molecule catabolic process [inference]

monosaccharide catabolic process [inference]

hexose catabolic process [inference]

L-fucose catabolic process

carbohydrate derivative metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

glycosphingolipid biosynthetic process

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	TAS	Reactome Reactome Reactome Reactome
Golgi apparatus	TAS	PMID
Golgi apparatus	IDA	PMID
Golgi apparatus	IBA	GO_REF
Golgi cisterna membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

Golgi cisterna membrane

bounding membrane of organelle [inference]

Golgi membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular membrane-bounded organelle [inference]

Golgi apparatus

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
galactoside 2-alpha-L-fucosyltransferase activity	EXP	PMID
galactoside 2-alpha-L-fucosyltransferase activity	TAS	PMID Reactome Reactome Reactome
galactoside 2-alpha-L-fucosyltransferase activity	IBA	GO_REF
galactoside 2-alpha-L-fucosyltransferase activity	IEA	GO_REF GO_REF GO_REF
fucosyltransferase activity	TAS	PMID Reactome

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

hexosyltransferase activity [inference]

fucosyltransferase activity

alpha-(1,2)-fucosyltransferase activity

galactoside 2-alpha-L-fucosyltransferase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLVVQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQKFLRGLQVNGSRPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSLIFVVTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTGGDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
188	N-linked (GlcNAc...) asparagine	UniProt
282	N-linked (GlcNAc...) asparagine	UniProt
308	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
ABO blood group biosynthesis	Homo sapiens
Glycosphingolipid biosynthesis	Homo sapiens
Lewis blood group biosynthesis	Homo sapiens

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:0050731	vitamin B12 deficiency	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements