GlyCosmos Portal

Submissions

Iron transporter SMF3

Summary

UniProt ID: Q12078
Gene Symbol: SMF3 YLR034C
Gene ID: 850721
Organism: Saccharomyces cerevisiae S288C

External Links

Re-Glyco: Q12078

Annotation

Keyword: Endoplasmic reticulum Glycoprotein Iron transport Metal-binding Reference proteome Transmembrane helix Vacuole

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
iron ion transport	IMP	PMID
manganese ion transport
intracellular iron ion homeostasis	IMP	PMID
intracellular iron ion homeostasis	IBA	GO_REF
intracellular manganese ion homeostasis	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

iron ion transmembrane transport

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

monoatomic cation homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

manganese ion homeostasis [inference]

intracellular manganese ion homeostasis

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

inorganic ion homeostasis [inference]

intracellular iron ion homeostasis

manganese ion homeostasis [inference]

intracellular manganese ion homeostasis

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport [inference]

metal ion transport [inference]

transition metal ion transport [inference]

iron ion transport

iron ion transmembrane transport

manganese ion transport

monoatomic cation transmembrane transport [inference]

iron ion transmembrane transport

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

iron ion transmembrane transport

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

iron ion transmembrane transport

Displaying **all 4** entries
GO Term	Evidence Code	Reference
fungal-type vacuole membrane	IDA	PMID
fungal-type vacuole membrane	IBA	GO_REF
fungal-type vacuole membrane	HDA	PMID
endoplasmic reticulum membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

endoplasmic reticulum membrane

bounding membrane of organelle [inference]

vacuolar membrane [inference]

lytic vacuole membrane [inference]

fungal-type vacuole membrane

Displaying **all 3** entries
GO Term	Evidence Code	Reference
manganese ion transmembrane transporter activity
obsolete inorganic cation transmembrane transporter activity
metal ion binding

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity [inference]

metal ion transmembrane transporter activity [inference]

transition metal ion transmembrane transporter activity [inference]

manganese ion transmembrane transporter activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRSYMQILQKFAKFIGPGILVSVAYMDPGNYATSVSGGAQYKYTLLFSIFISNIFAVLLQCLCVKLGTITGYDLAENCRHNLPKKLNYTLYLFAEVAIIATDLAEVVGTAIALQILFKIPLTWGVLLTVLDVLVILMFYTPNGQSLKKVRVFEFGVGILVIGTCICFVLELFKVSIPDKAELFKGFLPSNIIFKEQQALYISLGILGATVMPHSLYLGSSIVKPRLHDYDLKKYGKVNARPSLSAIKYTLNYAYAELIISLFLIATFVNSAILIVAGATLSGQPEAEDADLLSIYKLLVHYISPAAGLIFALAMLCSGQSAGIICTLAGQIVSEGFLQWSLPPWATRLCTRLIAIVPCLFVTLTMGEKGISDILNFSQVVLSLILPIVSAPLIYFTANRKLMVVHDENGVVRAPADVNAIADETTPLNSKHSKIVDFTNSRLLTYTSVFVWALIGSLNCYLVISYLLGADIHF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites