GlyCosmos Portal

Submissions

Aspartic proteinase yapsin-3

Summary

UniProt ID: Q12303
Gene Symbol: L2964 L9233.10 YLR121C YPS3
Gene ID: 850812
Organism: Saccharomyces cerevisiae S288C

External Links

Re-Glyco: Q12303

Annotation

Keyword: Aspartyl protease Cell membrane Cleavage on pair of basic residues Direct protein sequencing GPI-anchor Reference proteome Signal Zymogen

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
proteolysis	IEA	GO_REF
fungal-type cell wall organization	IGI	PMID
fungal-type cell wall organization	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

protein metabolic process [inference]

proteolysis

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis

cell wall organization or biogenesis [inference]

cell wall organization [inference]

fungal-type cell wall organization

fungal-type cell wall organization or biogenesis [inference]

fungal-type cell wall organization

cellular component organization or biogenesis [inference]

cellular component organization [inference]

external encapsulating structure organization [inference]

cell wall organization [inference]

fungal-type cell wall organization

Displaying **all 5** entries
GO Term	Evidence Code	Reference
extracellular region	IBA	GO_REF
plasma membrane	IDA	PMID
plasma membrane	IEA	GO_REF
fungal-type cell wall	IBA	GO_REF
side of membrane

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

membrane [inference]

plasma membrane

external encapsulating structure [inference]

cell wall [inference]

fungal-type cell wall

side of membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
aspartic-type endopeptidase activity	ISS	PMID
aspartic-type endopeptidase activity	IDA	PMID
aspartic-type endopeptidase activity	IBA	GO_REF
aspartic-type endopeptidase activity	IEA	GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

endopeptidase activity [inference]

aspartic-type endopeptidase activity

aspartic-type peptidase activity [inference]

aspartic-type endopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

endopeptidase activity [inference]

aspartic-type endopeptidase activity

aspartic-type peptidase activity [inference]

aspartic-type endopeptidase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKLQLAAVATLAVLTSPAFGRVLPDGKYVKIPFTKKKNGDNGELSKRSNGHEKFVLANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGSVMDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTYAEGAFGQDKLKYNELDLSGLSFAVANESNSTFGVLGIGLSTLEVTYSGKVAIMDKRSYEYDNFPLFLKHSGAIDATAYSLFLNDESQSSGSILFGAVDHSKYEGQLYTIPLVNLYKSQGYQHPVAFDVTLQGLGLQTDKRNITLTTTKLPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKTSVAFDFGGFRINAPLSDFTMQTSVGTCVLAIIPQAGNATAILGDSFLRNAYVVYDLDNYEISLAQAKYGTGKENVEVIKSTVPSAIRAPSYNNTWSNYASATSGGNIFTTVRTFNGTSTATTTRSTTTKKTNSTTTAKSTHKSKRALQRAATNSASSIRSTLGLLLVPSLLILSVFFS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying entries **1 - 10** of 11 in total

1

2

Next ›

Last »
Position	Description	Source
75	N-linked (GlcNAc...) asparagine	UniProt
120	N-linked (GlcNAc...) asparagine	UniProt
160	N-linked (GlcNAc...) asparagine	UniProt
163	N-linked (GlcNAc...) asparagine	UniProt
275	N-linked (GlcNAc...) asparagine	UniProt
309	N-linked (GlcNAc...) asparagine	UniProt
328	N-linked (GlcNAc...) asparagine	UniProt
367	N-linked (GlcNAc...) asparagine	UniProt
422	N-linked (GlcNAc...) asparagine	UniProt
445	N-linked (GlcNAc...) asparagine	UniProt