GlyCosmos Portal

Submissions

mRNA export factor GLE1

Summary

UniProt ID: Q12315
Gene Symbol: BRR3 D1049 GLE1 RSS1 YDL207W
Gene ID: 851320
Organism: Saccharomyces cerevisiae S288C

External Links

GlyGen: Q12315
O-GlcNAcAtlas: Q12315
Re-Glyco: Q12315

Annotation

Keyword: 3D-structure Coiled coil Membrane Nuclear pore complex Reference proteome mRNA processing

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
mRNA processing
mRNA export from nucleus	IMP	PMID
tRNA export from nucleus	IDA	PMID
regulation of translational initiation	IMP	PMID
regulation of translational termination	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing

RNA processing [inference]

mRNA processing

intercellular transport [inference]

nuclear export [inference]

RNA export from nucleus [inference]

mRNA export from nucleus

poly(A)+ mRNA export from nucleus

tRNA export from nucleus

cellular localization [inference]

intracellular transport [inference]

nuclear transport [inference]

nucleocytoplasmic transport

nuclear export [inference]

RNA export from nucleus [inference]

mRNA export from nucleus

poly(A)+ mRNA export from nucleus

tRNA export from nucleus

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport

establishment of localization [inference]

transport [inference]

intercellular transport [inference]

nuclear export [inference]

RNA export from nucleus [inference]

mRNA export from nucleus

poly(A)+ mRNA export from nucleus

tRNA export from nucleus

protein transport

intracellular transport [inference]

nuclear transport [inference]

nucleocytoplasmic transport

nuclear export [inference]

RNA export from nucleus [inference]

mRNA export from nucleus

poly(A)+ mRNA export from nucleus

tRNA export from nucleus

nitrogen compound transport [inference]

nucleobase-containing compound transport [inference]

nucleic acid transport [inference]

RNA transport [inference]

RNA export from nucleus [inference]

mRNA export from nucleus

poly(A)+ mRNA export from nucleus

tRNA export from nucleus

mRNA transport [inference]

mRNA export from nucleus

poly(A)+ mRNA export from nucleus

tRNA transport [inference]

tRNA export from nucleus

establishment of protein localization [inference]

protein transport

establishment of RNA localization [inference]

RNA transport [inference]

RNA export from nucleus [inference]

mRNA export from nucleus

poly(A)+ mRNA export from nucleus

tRNA export from nucleus

mRNA transport [inference]

mRNA export from nucleus

poly(A)+ mRNA export from nucleus

tRNA transport [inference]

tRNA export from nucleus

establishment of localization in cell [inference]

intracellular transport [inference]

nuclear transport [inference]

nucleocytoplasmic transport

nuclear export [inference]

RNA export from nucleus [inference]

mRNA export from nucleus

poly(A)+ mRNA export from nucleus

tRNA export from nucleus

cellular localization [inference]

intracellular transport [inference]

nuclear transport [inference]

nucleocytoplasmic transport

nuclear export [inference]

RNA export from nucleus [inference]

mRNA export from nucleus

poly(A)+ mRNA export from nucleus

tRNA export from nucleus

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

post-transcriptional regulation of gene expression [inference]

regulation of translation [inference]

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

post-transcriptional regulation of gene expression [inference]

regulation of translation [inference]

regulation of protein metabolic process [inference]

regulation of translation [inference]

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of translation [inference]

regulation of cellular component organization [inference]

regulation of protein-containing complex disassembly [inference]

regulation of translational termination

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
nuclear envelope	NAS	PMID
nuclear pore	NAS	PMID
nuclear pore	IDA	PMID PMID
nuclear pore	IEA	GO_REF GO_REF GO_REF
cytoplasm	IDA	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

nuclear protein-containing complex [inference]

cellular anatomical structure [inference]

cytoplasm

membrane [inference]

organelle membrane [inference]

nuclear membrane

organelle envelope [inference]

nuclear envelope

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
inositol hexakisphosphate binding	IDA	PMID
inositol hexakisphosphate binding	IBA	GO_REF
phospholipid binding	IDA	PMID
phospholipid binding	IBA	GO_REF
enzyme activator activity	IDA	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

translation initiation factor binding

lipid binding [inference]

phospholipid binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

inositol hexakisphosphate binding

alcohol binding [inference]

inositol hexakisphosphate binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity

molecular function activator activity [inference]

enzyme activator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRFVFDEVFNSDTDSPEFEETCSTTSSTSSQCPTPEPSPAIKLPSFTKVGTKKLVNESVVILDPALENALRDLNLQSKLIPINEPIVAASSIIVPHSTNMPLPRASHSSLLDNAKNSNATAPLLEAIEESFQRKMQNLVLANQKEIQSIRENKRRVEEQRKRKEEEERKRKEAEEKAKREQELLRQKKDEEERKRKEAEAKLAQQKQEEERKKIEEQNEKERQLKKEHEAKLLQQKDKLGKAVTNFDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVHQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites