GlyCosmos Portal

Annotation

Keyword: 3D-structure Alternative splicing Calcium Collagen Complement activation lectin pathway Direct protein sequencing Disulfide bond Glycoprotein Hydroxylation Lectin Metal-binding Proteomics identification Reference proteome Repeat Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
complement activation, lectin pathway	IDA	PMID PMID PMID
complement activation, lectin pathway	IBA	GO_REF
cell surface pattern recognition receptor signaling pathway	NAS	PMID
proteolysis	IDA	PMID
opsonization	IDA	PMID

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

complement activation [inference]

complement activation, lectin pathway

opsonization

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

complement activation [inference]

complement activation, lectin pathway

immune response [inference]

humoral immune response [inference]

complement activation [inference]

complement activation, lectin pathway

innate immune response [inference]

complement activation, lectin pathway

cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

cell recognition [inference]

phagocytosis, recognition [inference]

recognition of apoptotic cell

metabolic process [inference]

macromolecule metabolic process [inference]

protein metabolic process [inference]

proteolysis

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

complement activation, lectin pathway

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to bacterium [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

complement activation, lectin pathway

immune response [inference]

humoral immune response [inference]

complement activation [inference]

complement activation, lectin pathway

innate immune response [inference]

complement activation, lectin pathway

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

complement activation, lectin pathway

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

complement activation, lectin pathway

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of opsonization

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

complement activation [inference]

complement activation, lectin pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

regulation of immune effector process [inference]

positive regulation of immune effector process [inference]

positive regulation of opsonization

regulation of opsonization [inference]

positive regulation of opsonization

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

complement activation [inference]

complement activation, lectin pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

regulation of localization [inference]

regulation of transport [inference]

positive regulation of transport [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis [inference]

positive regulation of opsonization

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis [inference]

positive regulation of opsonization

regulation of phagocytosis [inference]

positive regulation of phagocytosis [inference]

positive regulation of opsonization

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of opsonization

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

complement activation [inference]

complement activation, lectin pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis [inference]

positive regulation of opsonization

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

complement activation [inference]

complement activation, lectin pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

positive regulation of transport [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis [inference]

positive regulation of opsonization

regulation of response to stimulus [inference]

regulation of response to biotic stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

complement activation [inference]

complement activation, lectin pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

complement activation [inference]

complement activation, lectin pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

regulation of response to stress [inference]

regulation of defense response [inference]

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

pattern recognition receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

cell surface pattern recognition receptor signaling pathway

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis [inference]

positive regulation of opsonization

regulation of cellular component organization [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis [inference]

positive regulation of opsonization

regulation of phagocytosis [inference]

positive regulation of phagocytosis [inference]

positive regulation of opsonization

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis [inference]

positive regulation of opsonization

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis [inference]

positive regulation of opsonization

regulation of phagocytosis [inference]

positive regulation of phagocytosis [inference]

positive regulation of opsonization

regulation of opsonization [inference]

positive regulation of opsonization

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	EXP	PMID PMID
extracellular region	TAS	Reactome Reactome Reactome Reactome
extracellular region	IEA	GO_REF
collagen trimer
obsolete extracellular space

GO Hierarchy

cellular component

protein-containing complex [inference]

collagen trimer

catalytic complex [inference]

peptidase complex [inference]

serine-type peptidase complex [inference]

serine-type endopeptidase complex

endopeptidase complex [inference]

serine-type endopeptidase complex

cellular anatomical structure [inference]

extracellular region

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

other organism part [inference]

symbiont cell surface

blood microparticle

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
antigen binding	IDA	PMID
antigen binding	IBA	GO_REF
signaling receptor binding	IBA	GO_REF
pattern recognition receptor activity	IDA	PMID PMID
proteoglycan binding	IDA	PMID

GO Hierarchy

molecular function

binding [inference]

antigen binding

protein binding [inference]

carbohydrate binding [inference]

polysaccharide binding [inference]

mannan binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

carbohydrate derivative binding

proteoglycan binding

molecular transducer activity [inference]

signaling receptor activity [inference]

pattern recognition receptor activity

lipoteichoic acid immune receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
240	N-linked (GlcNAc...) asparagine	17215869		UniProt GlyGen
300	N-linked (GlcNAc...) asparagine			UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Ficolins bind to repetitive carbohydrate structures on the target cell surface	Homo sapiens
Initial triggering of complement	Homo sapiens
Lectin pathway of complement activation	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements