GlyCosmos Portal

Submissions

Transcription initiation factor TFIID subunit 7

Summary

UniProt ID: Q15545
Gene Symbol: TAF7 TAF2F TAFII55
Gene ID: 6879
Organism: Homo sapiens (human)

External Links

The O-GlcNAc Database: Q15545
Re-Glyco: Q15545

Annotation

Keyword: 3D-structure Coiled coil Nucleus Phosphoprotein Proteomics identification Reference proteome Transcription regulation Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 23 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II	IDA	PMID
spermine transport	ISS	GO_REF
regulation of DNA repair	NAS	PMID
chromatin organization	IEA	GO_REF
DNA-templated transcription initiation	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

hormone-mediated signaling pathway [inference]

steroid hormone receptor signaling pathway [inference]

nuclear receptor-mediated steroid hormone signaling pathway [inference]

estrogen receptor signaling pathway

intracellular signal transduction [inference]

intracellular receptor signaling pathway [inference]

nuclear receptor-mediated signaling pathway [inference]

nuclear receptor-mediated steroid hormone signaling pathway [inference]

estrogen receptor signaling pathway

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

mRNA transcription by RNA polymerase II

mRNA transcription [inference]

mRNA transcription by RNA polymerase II

DNA-templated transcription initiation

transcription initiation at RNA polymerase II promoter

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

mRNA transcription by RNA polymerase II

mRNA transcription [inference]

mRNA transcription by RNA polymerase II

DNA-templated transcription initiation

transcription initiation at RNA polymerase II promoter

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

mRNA transcription by RNA polymerase II

mRNA transcription [inference]

mRNA transcription by RNA polymerase II

DNA-templated transcription initiation

transcription initiation at RNA polymerase II promoter

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA transcription [inference]

mRNA transcription by RNA polymerase II

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

mRNA transcription by RNA polymerase II

mRNA transcription [inference]

mRNA transcription by RNA polymerase II

DNA-templated transcription initiation

transcription initiation at RNA polymerase II promoter

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

mRNA transcription by RNA polymerase II

mRNA transcription [inference]

mRNA transcription by RNA polymerase II

DNA-templated transcription initiation

transcription initiation at RNA polymerase II promoter

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

mRNA transcription by RNA polymerase II

mRNA transcription [inference]

mRNA transcription by RNA polymerase II

DNA-templated transcription initiation

transcription initiation at RNA polymerase II promoter

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA transcription [inference]

mRNA transcription by RNA polymerase II

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

mRNA transcription by RNA polymerase II

mRNA transcription [inference]

mRNA transcription by RNA polymerase II

DNA-templated transcription initiation

transcription initiation at RNA polymerase II promoter

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

mRNA transcription by RNA polymerase II

mRNA transcription [inference]

mRNA transcription by RNA polymerase II

DNA-templated transcription initiation

transcription initiation at RNA polymerase II promoter

cellular component organization or biogenesis [inference]

cellular component organization [inference]

chromatin organization

cellular component assembly [inference]

protein-containing complex assembly [inference]

protein-DNA complex assembly [inference]

transcription preinitiation complex assembly [inference]

RNA polymerase II preinitiation complex assembly

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

protein-DNA complex assembly [inference]

transcription preinitiation complex assembly [inference]

RNA polymerase II preinitiation complex assembly

protein-DNA complex organization [inference]

protein-DNA complex assembly [inference]

transcription preinitiation complex assembly [inference]

RNA polymerase II preinitiation complex assembly

localization [inference]

establishment of localization [inference]

transport [inference]

nitrogen compound transport [inference]

polyamine transport [inference]

spermine transport

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of response to stimulus [inference]

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of DNA repair

regulation of cellular process [inference]

signal transduction [inference]

hormone-mediated signaling pathway [inference]

steroid hormone receptor signaling pathway [inference]

nuclear receptor-mediated steroid hormone signaling pathway [inference]

estrogen receptor signaling pathway

intracellular signal transduction [inference]

intracellular receptor signaling pathway [inference]

nuclear receptor-mediated signaling pathway [inference]

nuclear receptor-mediated steroid hormone signaling pathway [inference]

estrogen receptor signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

negative regulation of transcription by RNA polymerase II

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

regulation of transcription initiation by RNA polymerase II [inference]

positive regulation of transcription initiation by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

regulation of DNA-templated transcription initiation [inference]

regulation of transcription initiation by RNA polymerase II [inference]

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of MHC class I biosynthetic process [inference]

negative regulation of MHC class I biosynthetic process

regulation of MHC class II biosynthetic process [inference]

negative regulation of MHC class II biosynthetic process

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

negative regulation of transcription by RNA polymerase II

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

regulation of transcription initiation by RNA polymerase II [inference]

positive regulation of transcription initiation by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

regulation of DNA-templated transcription initiation [inference]

regulation of transcription initiation by RNA polymerase II [inference]

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

regulation of phosphorus metabolic process [inference]

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

regulation of phosphorylation [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

regulation of kinase activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

negative regulation of transcription by RNA polymerase II

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

regulation of transcription initiation by RNA polymerase II [inference]

positive regulation of transcription initiation by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

regulation of DNA-templated transcription initiation [inference]

regulation of transcription initiation by RNA polymerase II [inference]

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of MHC class I biosynthetic process [inference]

negative regulation of MHC class I biosynthetic process

regulation of MHC class II biosynthetic process [inference]

negative regulation of MHC class II biosynthetic process

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

negative regulation of transcription by RNA polymerase II

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

regulation of transcription initiation by RNA polymerase II [inference]

positive regulation of transcription initiation by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

regulation of DNA-templated transcription initiation [inference]

regulation of transcription initiation by RNA polymerase II [inference]

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of DNA metabolic process [inference]

regulation of DNA repair

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

negative regulation of transcription by RNA polymerase II

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

regulation of transcription initiation by RNA polymerase II [inference]

positive regulation of transcription initiation by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

regulation of DNA-templated transcription initiation [inference]

regulation of transcription initiation by RNA polymerase II [inference]

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of DNA metabolic process [inference]

regulation of DNA repair

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

negative regulation of transcription by RNA polymerase II

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

regulation of transcription initiation by RNA polymerase II [inference]

positive regulation of transcription initiation by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

regulation of DNA-templated transcription initiation [inference]

regulation of transcription initiation by RNA polymerase II [inference]

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of transcription initiation by RNA polymerase II

positive regulation of DNA-templated transcription initiation [inference]

positive regulation of transcription initiation by RNA polymerase II

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of cellular response to stress [inference]

regulation of DNA repair

regulation of molecular function [inference]

negative regulation of molecular function [inference]

negative regulation of catalytic activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

regulation of catalytic activity [inference]

negative regulation of catalytic activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

regulation of transferase activity [inference]

regulation of kinase activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
male germ cell nucleus
nucleus	ISS	GO_REF
nucleus	EXP	PMID
nucleus	IDA	PMID
nucleus	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

transcription regulator complex

RNA polymerase II transcription regulator complex [inference]

nuclear protein-containing complex [inference]

histone methyltransferase complex [inference]

MLL1/2 complex [inference]

MLL1 complex

RNA polymerase II transcription regulator complex [inference]

intracellular protein-containing complex [inference]

protein acetyltransferase complex [inference]

histone acetyltransferase complex [inference]

SAGA-type complex [inference]

transcription factor TFTC complex

catalytic complex [inference]

transferase complex [inference]

methyltransferase complex [inference]

histone methyltransferase complex [inference]

MLL1/2 complex [inference]

MLL1 complex

acetyltransferase complex [inference]

protein acetyltransferase complex [inference]

histone acetyltransferase complex [inference]

SAGA-type complex [inference]

transcription factor TFTC complex

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

germ cell nucleus [inference]

male germ cell nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

germ cell nucleus [inference]

male germ cell nucleus

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
transcription cis-regulatory region binding	IDA	PMID
TFIIH-class transcription factor complex binding	IDA	PMID
RNA polymerase II general transcription initiation factor activity	IDA	PMID PMID PMID
RNA polymerase II general transcription initiation factor activity	IBA	GO_REF
histone acetyltransferase binding	IPI	PMID

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

transcription regulatory region nucleic acid binding [inference]

transcription cis-regulatory region binding

DNA binding [inference]

double-stranded DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding

sequence-specific DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding

protein binding [inference]

transcription factor binding [inference]

general transcription initiation factor binding [inference]

RNA polymerase II general transcription initiation factor binding [inference]

TFIIH-class transcription factor complex binding

DNA-binding transcription factor binding

RNA polymerase II-specific DNA-binding transcription factor binding [inference]

nuclear receptor binding [inference]

enzyme binding [inference]

histone acetyltransferase binding

RNA polymerase binding [inference]

RNA polymerase core enzyme binding [inference]

RNA polymerase II complex binding [inference]

RNA polymerase II general transcription initiation factor binding [inference]

TFIIH-class transcription factor complex binding

protein dimerization activity [inference]

protein heterodimerization activity

protein-containing complex binding [inference]

P-TEFb complex binding

general transcription initiation factor activity [inference]

RNA polymerase II general transcription initiation factor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
236		38253038 40596516	G49108TO	The O-GlcNAc Database
249		38253038 40596516	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 9** entries
Pathway Name	Organism
HIV Transcription Initiation	Homo sapiens
RNA Polymerase II HIV Promoter Escape	Homo sapiens
RNA Polymerase II Pre-transcription Events	Homo sapiens
RNA Polymerase II Promoter Escape	Homo sapiens
RNA Polymerase II Transcription Initiation	Homo sapiens
RNA Polymerase II Transcription Initiation And Promoter Clearance	Homo sapiens
RNA Polymerase II Transcription Pre-Initiation And Promoter Opening	Homo sapiens
Regulation of TP53 Activity through Phosphorylation	Homo sapiens
Transcription of the HIV genome	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements