GlyCosmos Portal

Submissions

Neuropeptide Y receptor type 5

Summary

UniProt ID

Q15761

Gene Symbol

NPY5R
NPYR5

Gene ID

[4889]

Organism

Homo sapiens (human)

External Links

PubChem: Q15761
The Human Metabolome Database: HMDBP13638
Re-Glyco: Q15761

Annotation

Keyword: Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Palmitate Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of acute inflammatory response	IEA	GO_REF
negative regulation of acute inflammatory response to antigenic stimulus	IEA	GO_REF
outflow tract morphogenesis	IMP	PMID
cardiac left ventricle morphogenesis	IMP	PMID
G protein-coupled receptor signaling pathway	TAS	PMID

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling [inference]

synaptic signaling [inference]

trans-synaptic signaling [inference]

anterograde trans-synaptic signaling [inference]

chemical synaptic transmission

synaptic signaling via neuropeptide

signal transduction [inference]

G protein-coupled receptor signaling pathway

reproductive process [inference]

ovulation cycle process [inference]

generation of ovulation cycle rhythm

multicellular organismal process [inference]

behavior [inference]

feeding behavior [inference]

eating behavior

developmental process [inference]

anatomical structure morphogenesis [inference]

outflow tract morphogenesis

cardiac chamber morphogenesis [inference]

cardiac ventricle morphogenesis [inference]

cardiac left ventricle morphogenesis

rhythmic process [inference]

ovulation cycle process [inference]

generation of ovulation cycle rhythm

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of immune response [inference]

negative regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

regulation of immune response [inference]

regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

regulation of acute inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of immune response [inference]

negative regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

negative regulation of signaling [inference]

negative regulation of synaptic transmission [inference]

negative regulation of synaptic transmission, GABAergic

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic transmission, GABAergic [inference]

negative regulation of synaptic transmission, GABAergic

negative regulation of synaptic transmission [inference]

negative regulation of synaptic transmission, GABAergic

signaling [inference]

cell-cell signaling [inference]

synaptic signaling [inference]

trans-synaptic signaling [inference]

anterograde trans-synaptic signaling [inference]

chemical synaptic transmission

synaptic signaling via neuropeptide

regulation of localization [inference]

regulation of transport [inference]

regulation of organic acid transport [inference]

regulation of glutamate secretion [inference]

negative regulation of glutamate secretion

negative regulation of organic acid transport [inference]

negative regulation of glutamate secretion

regulation of secretion [inference]

negative regulation of secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of glutamate secretion

regulation of secretion by cell [inference]

regulation of glutamate secretion [inference]

negative regulation of glutamate secretion

negative regulation of secretion by cell [inference]

negative regulation of glutamate secretion

negative regulation of transport [inference]

negative regulation of organic acid transport [inference]

negative regulation of glutamate secretion

negative regulation of secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of glutamate secretion

negative regulation of amine transport [inference]

negative regulation of amino acid transport [inference]

negative regulation of glutamate secretion

regulation of amine transport [inference]

negative regulation of amine transport [inference]

negative regulation of amino acid transport [inference]

negative regulation of glutamate secretion

regulation of amino acid transport [inference]

regulation of glutamate secretion [inference]

negative regulation of glutamate secretion

negative regulation of amino acid transport [inference]

negative regulation of glutamate secretion

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of smooth muscle cell proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of defense response [inference]

positive regulation of inflammatory response [inference]

positive regulation of acute inflammatory response

positive regulation of response to external stimulus [inference]

positive regulation of inflammatory response [inference]

positive regulation of acute inflammatory response

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of immune response [inference]

negative regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of signaling [inference]

negative regulation of synaptic transmission [inference]

negative regulation of synaptic transmission, GABAergic

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of synaptic transmission [inference]

negative regulation of synaptic transmission, GABAergic

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of secretion by cell [inference]

negative regulation of glutamate secretion

negative regulation of response to stimulus [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of immune response [inference]

negative regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of transport [inference]

negative regulation of organic acid transport [inference]

negative regulation of glutamate secretion

negative regulation of secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of glutamate secretion

negative regulation of amine transport [inference]

negative regulation of amino acid transport [inference]

negative regulation of glutamate secretion

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

positive regulation of response to external stimulus [inference]

positive regulation of inflammatory response [inference]

positive regulation of acute inflammatory response

regulation of inflammatory response [inference]

regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

positive regulation of acute inflammatory response

regulation of acute inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

regulation of acute inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

positive regulation of inflammatory response [inference]

positive regulation of acute inflammatory response

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of defense response [inference]

positive regulation of inflammatory response [inference]

positive regulation of acute inflammatory response

positive regulation of response to external stimulus [inference]

positive regulation of inflammatory response [inference]

positive regulation of acute inflammatory response

negative regulation of response to stimulus [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of immune response [inference]

negative regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

regulation of immune response [inference]

regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

regulation of acute inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of immune response [inference]

negative regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

regulation of response to stress [inference]

regulation of defense response [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

positive regulation of defense response [inference]

positive regulation of inflammatory response [inference]

positive regulation of acute inflammatory response

regulation of inflammatory response [inference]

regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

positive regulation of acute inflammatory response

regulation of acute inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

regulation of acute inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of inflammatory response [inference]

negative regulation of acute inflammatory response [inference]

negative regulation of acute inflammatory response to antigenic stimulus

negative regulation of inflammatory response to antigenic stimulus [inference]

negative regulation of acute inflammatory response to antigenic stimulus

positive regulation of inflammatory response [inference]

positive regulation of acute inflammatory response

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

negative regulation of cell communication [inference]

negative regulation of synaptic transmission [inference]

negative regulation of synaptic transmission, GABAergic

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic transmission, GABAergic [inference]

negative regulation of synaptic transmission, GABAergic

negative regulation of synaptic transmission [inference]

negative regulation of synaptic transmission, GABAergic

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of smooth muscle cell proliferation

regulation of smooth muscle cell proliferation [inference]

positive regulation of smooth muscle cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of smooth muscle cell proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of synaptic transmission [inference]

negative regulation of synaptic transmission, GABAergic

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of secretion by cell [inference]

negative regulation of glutamate secretion

regulation of secretion by cell [inference]

regulation of glutamate secretion [inference]

negative regulation of glutamate secretion

negative regulation of secretion by cell [inference]

negative regulation of glutamate secretion

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	TAS	PMID Reactome Reactome Reactome Reactome
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF
neuron projection	IBA	GO_REF
neuron projection	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

cell junction [inference]

synapse [inference]

GABA-ergic synapse

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection

presynapse

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
peptide YY receptor activity	IBA	GO_REF
peptide YY receptor activity	IEA	GO_REF
pancreatic polypeptide receptor activity	IBA	GO_REF
pancreatic polypeptide receptor activity	IEA	GO_REF
neuropeptide Y receptor activity	TAS	PMID

GO Hierarchy

molecular function

binding [inference]

peptide binding [inference]

neuropeptide binding

molecular transducer activity [inference]

signaling receptor activity [inference]

peptide receptor activity [inference]

G protein-coupled peptide receptor activity [inference]

neuropeptide receptor activity [inference]

neuropeptide Y receptor activity

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity [inference]

G protein-coupled peptide receptor activity [inference]

neuropeptide receptor activity [inference]

neuropeptide Y receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
10	N-linked (GlcNAc...) asparagine			UniProt
17	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
G alpha (i) signalling events	Homo sapiens
Peptide ligand-binding receptors	Homo sapiens

Disease

Displaying **all 2** entries
DO ID	Disease Name	Source
DOID:3146	lipid metabolism disorder	Alliance of Genome Resources
DOID:9970	obesity	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements