GlyCosmos Portal

Submissions

snRNA-activating protein complex subunit 1

Summary

UniProt ID: Q16533
Gene Symbol: SNAPC1 SNAP43
Gene ID: 6617
Organism: Homo sapiens (human)

External Links

PubChem: Q16533
The O-GlcNAc Database: Q16533
Re-Glyco: Q16533

Annotation

Keyword: 3D-structure DNA-binding Direct protein sequencing Nucleus Phosphoprotein Proteomics identification Reference proteome Transcription regulation

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
snRNA transcription by RNA polymerase II	NAS	PMID
snRNA transcription by RNA polymerase II	IBA	GO_REF
snRNA transcription by RNA polymerase III	NAS	PMID
snRNA transcription by RNA polymerase III	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II [inference]

snRNA transcription by RNA polymerase II

transcription by RNA polymerase III [inference]

snRNA transcription by RNA polymerase III

snRNA transcription [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II [inference]

snRNA transcription by RNA polymerase II

transcription by RNA polymerase III [inference]

snRNA transcription by RNA polymerase III

snRNA transcription [inference]

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II [inference]

snRNA transcription by RNA polymerase II

transcription by RNA polymerase III [inference]

snRNA transcription by RNA polymerase III

snRNA transcription [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

snRNA metabolic process [inference]

snRNA transcription [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II [inference]

snRNA transcription by RNA polymerase II

transcription by RNA polymerase III [inference]

snRNA transcription by RNA polymerase III

snRNA transcription [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II [inference]

snRNA transcription by RNA polymerase II

transcription by RNA polymerase III [inference]

snRNA transcription by RNA polymerase III

snRNA transcription [inference]

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II [inference]

snRNA transcription by RNA polymerase II

transcription by RNA polymerase III [inference]

snRNA transcription by RNA polymerase III

snRNA transcription [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

snRNA metabolic process [inference]

snRNA transcription [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II [inference]

snRNA transcription by RNA polymerase II

transcription by RNA polymerase III [inference]

snRNA transcription by RNA polymerase III

snRNA transcription [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II [inference]

snRNA transcription by RNA polymerase II

transcription by RNA polymerase III [inference]

snRNA transcription by RNA polymerase III

snRNA transcription [inference]

Displaying **all 5** entries
GO Term	Evidence Code	Reference
nucleoplasm	TAS	Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome
nucleoplasm	IDA	GO_REF
nucleolus	IDA	GO_REF
snRNA-activating protein complex	IBA	GO_REF
snRNA-activating protein complex	IPI	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

transcription regulator complex [inference]

snRNA-activating protein complex

cellular anatomical structure [inference]

nucleoplasm

organelle [inference]

membraneless organelle [inference]

intracellular membraneless organelle [inference]

nucleolus

intracellular organelle [inference]

intracellular membraneless organelle [inference]

nucleolus

Displaying **all 3** entries
GO Term	Evidence Code	Reference
RNA polymerase III general transcription initiation factor activity	TAS	PMID
RNA polymerase II general transcription initiation factor activity	TAS	PMID
sequence-specific DNA binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

DNA binding [inference]

sequence-specific DNA binding

general transcription initiation factor activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGTPPGLQTDCEALLSRFQETDSVRFEDFTELWRNMKFGTIFCGRMRNLEKNMFTKEALALAWRYFLPPYTFQIRVGALYLLYGLYNTQLCQPKQKIRVALKDWDEVLKFQQDLVNAQHFDAAYIFRKLRLDRAFHFTAMPKLLSYRMKKKIHRAEVTEEFKDPSDRVMKLITSDVLEEMLNVHDHYQNMKHVISVDKSKPDKALSLIKDDFFDNIKNIVLEHQQWHKDRKNPSLKSKTNDGEEKMEGNSQETERCERAESLAKIKSKAFSVVIQASKSRRHRQVKLDSSDSDSASGQGQVKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDKPLSLSMPVITEEEENESLSGTEFTASKKRRKH

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
234		37340703 40596516	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
RNA Polymerase III Abortive And Retractive Initiation	Homo sapiens
RNA Polymerase III Transcription Initiation From Type 3 Promoter	Homo sapiens
RNA polymerase II transcribes snRNA genes	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements