GlyCosmos Portal

Submissions

SLAM family member 5

Summary

UniProt ID: Q18PI6
Gene Symbol: Cd84 Slamf5
Gene ID: 12523
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0004031
PubChem: Q18PI6
Re-Glyco: Q18PI6

Annotation

Keyword: Adaptive immunity Alternative splicing Autophagy Cell adhesion Cell membrane Disulfide bond Glycoprotein Immunoglobulin domain Innate immunity Phosphoprotein Receptor Reference proteome Repeat Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
adaptive immune response
autophagy
immune response	IBA	GO_REF
cell adhesion
regulation of lipopolysaccharide-mediated signaling pathway	IDA	PMID

GO Hierarchy

biological process

immune system process [inference]

immune response

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation

cell adhesion

metabolic process [inference]

catabolic process [inference]

autophagy

process utilizing autophagic mechanism [inference]

autophagy

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of mast cell activation

negative regulation of immune effector process [inference]

negative regulation of leukocyte mediated immunity [inference]

negative regulation of myeloid leukocyte mediated immunity [inference]

negative regulation of mast cell degranulation

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of mast cell activation

regulation of mast cell activation [inference]

negative regulation of mast cell activation

regulation of macrophage activation

regulation of immune effector process [inference]

negative regulation of immune effector process [inference]

negative regulation of leukocyte mediated immunity [inference]

negative regulation of myeloid leukocyte mediated immunity [inference]

negative regulation of mast cell degranulation

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

regulation of leukocyte mediated immunity [inference]

negative regulation of leukocyte mediated immunity [inference]

negative regulation of myeloid leukocyte mediated immunity [inference]

negative regulation of mast cell degranulation

regulation of myeloid leukocyte mediated immunity [inference]

negative regulation of myeloid leukocyte mediated immunity [inference]

negative regulation of mast cell degranulation

regulation of mast cell degranulation [inference]

negative regulation of mast cell degranulation

regulation of leukocyte degranulation [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

regulation of mast cell degranulation [inference]

negative regulation of mast cell degranulation

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of lipopolysaccharide-mediated signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of localization [inference]

regulation of transport [inference]

regulation of monoatomic ion transport [inference]

regulation of metal ion transport [inference]

regulation of calcium ion transport [inference]

regulation of store-operated calcium entry

regulation of secretion [inference]

negative regulation of secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of exocytosis [inference]

negative regulation of regulated secretory pathway [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

negative regulation of exocytosis [inference]

negative regulation of regulated secretory pathway [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

regulation of regulated secretory pathway [inference]

regulation of leukocyte degranulation [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

regulation of mast cell degranulation [inference]

negative regulation of mast cell degranulation

negative regulation of regulated secretory pathway [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

negative regulation of secretion by cell [inference]

negative regulation of exocytosis [inference]

negative regulation of regulated secretory pathway [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

negative regulation of transport [inference]

negative regulation of secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of exocytosis [inference]

negative regulation of regulated secretory pathway [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

negative regulation of exocytosis [inference]

negative regulation of regulated secretory pathway [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

regulation of regulated secretory pathway [inference]

regulation of leukocyte degranulation [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

regulation of mast cell degranulation [inference]

negative regulation of mast cell degranulation

negative regulation of regulated secretory pathway [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of mast cell activation

negative regulation of immune effector process [inference]

negative regulation of leukocyte mediated immunity [inference]

negative regulation of myeloid leukocyte mediated immunity [inference]

negative regulation of mast cell degranulation

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of protein metabolic process [inference]

negative regulation of granulocyte macrophage colony-stimulating factor production

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of mast cell activation

negative regulation of secretion by cell [inference]

negative regulation of exocytosis [inference]

negative regulation of regulated secretory pathway [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

negative regulation of transport [inference]

negative regulation of secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of exocytosis [inference]

negative regulation of regulated secretory pathway [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of mast cell activation

regulation of response to stimulus [inference]

regulation of response to biotic stimulus [inference]

regulation of lipopolysaccharide-mediated signaling pathway

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of lipopolysaccharide-mediated signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of response to external stimulus [inference]

regulation of lipopolysaccharide-mediated signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of lipopolysaccharide-mediated signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of chemokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

regulation of monocyte chemotactic protein-1 production [inference]

positive regulation of monocyte chemotactic protein-1 production

regulation of granulocyte macrophage colony-stimulating factor production [inference]

negative regulation of granulocyte macrophage colony-stimulating factor production

regulation of interleukin-10 production [inference]

negative regulation of interleukin-10 production

regulation of interleukin-18 production [inference]

negative regulation of interleukin-18 production

regulation of interleukin-6 production [inference]

negative regulation of interleukin-6 production

regulation of tumor necrosis factor superfamily cytokine production [inference]

regulation of tumor necrosis factor production [inference]

positive regulation of tumor necrosis factor production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of protein metabolic process [inference]

negative regulation of granulocyte macrophage colony-stimulating factor production

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of chemokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

regulation of monocyte chemotactic protein-1 production [inference]

positive regulation of monocyte chemotactic protein-1 production

regulation of granulocyte macrophage colony-stimulating factor production [inference]

negative regulation of granulocyte macrophage colony-stimulating factor production

regulation of interleukin-10 production [inference]

negative regulation of interleukin-10 production

regulation of interleukin-18 production [inference]

negative regulation of interleukin-18 production

regulation of interleukin-6 production [inference]

negative regulation of interleukin-6 production

regulation of tumor necrosis factor superfamily cytokine production [inference]

regulation of tumor necrosis factor production [inference]

positive regulation of tumor necrosis factor production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of protein metabolic process [inference]

negative regulation of granulocyte macrophage colony-stimulating factor production

regulation of protein metabolic process [inference]

regulation of granulocyte macrophage colony-stimulating factor production [inference]

negative regulation of granulocyte macrophage colony-stimulating factor production

negative regulation of protein metabolic process [inference]

negative regulation of granulocyte macrophage colony-stimulating factor production

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of granulocyte macrophage colony-stimulating factor production [inference]

negative regulation of granulocyte macrophage colony-stimulating factor production

negative regulation of protein metabolic process [inference]

negative regulation of granulocyte macrophage colony-stimulating factor production

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of protein metabolic process [inference]

negative regulation of granulocyte macrophage colony-stimulating factor production

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of mast cell activation

negative regulation of secretion by cell [inference]

negative regulation of exocytosis [inference]

negative regulation of regulated secretory pathway [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of mast cell activation

regulation of mast cell activation [inference]

negative regulation of mast cell activation

regulation of macrophage activation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of mast cell activation

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

negative regulation of exocytosis [inference]

negative regulation of regulated secretory pathway [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

regulation of regulated secretory pathway [inference]

regulation of leukocyte degranulation [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

regulation of mast cell degranulation [inference]

negative regulation of mast cell degranulation

negative regulation of regulated secretory pathway [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

negative regulation of exocytosis [inference]

negative regulation of regulated secretory pathway [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

regulation of regulated secretory pathway [inference]

regulation of leukocyte degranulation [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

regulation of mast cell degranulation [inference]

negative regulation of mast cell degranulation

negative regulation of regulated secretory pathway [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

negative regulation of secretion by cell [inference]

negative regulation of exocytosis [inference]

negative regulation of regulated secretory pathway [inference]

negative regulation of leukocyte degranulation [inference]

negative regulation of mast cell degranulation

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of chemokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

regulation of monocyte chemotactic protein-1 production [inference]

positive regulation of monocyte chemotactic protein-1 production

regulation of granulocyte macrophage colony-stimulating factor production [inference]

negative regulation of granulocyte macrophage colony-stimulating factor production

regulation of interleukin-10 production [inference]

negative regulation of interleukin-10 production

regulation of interleukin-18 production [inference]

negative regulation of interleukin-18 production

regulation of interleukin-6 production [inference]

negative regulation of interleukin-6 production

regulation of tumor necrosis factor superfamily cytokine production [inference]

regulation of tumor necrosis factor production [inference]

positive regulation of tumor necrosis factor production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of mast cell activation

regulation of mast cell activation [inference]

negative regulation of mast cell activation

regulation of macrophage activation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of mast cell activation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of chemokine production [inference]

positive regulation of monocyte chemotactic protein-1 production

positive regulation of tumor necrosis factor superfamily cytokine production [inference]

positive regulation of tumor necrosis factor production

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of mast cell activation

Displaying **all 3** entries
GO Term	Evidence Code	Reference
plasma membrane	ISO	GO_REF
plasma membrane	IEA	GO_REF
external side of plasma membrane	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

side of membrane [inference]

external side of plasma membrane

Displaying 1 entry
GO Term	Evidence Code	Reference
identical protein binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

identical protein binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAQRHLWIWFLCLQTWSEAAGKDADPMVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLRMEDAGTYKADINEENEETITKIYYLHIYRRLKTPKITQSLISSLNNTCNITLTCSVEKEEKDVTYSWSPFGEKSNVLQIVHSPMDQKLTYTCTAQNPVSNSSDSVTVQQPCTDTPSFHPRHAVLPGGLAVLFLLILIPMLAFLFRLYKRRRDRIVLEADDVSKKTVYAVVSRNAQPTESRIYDEIPQSKMLSCKEDPVTTIYSSVQLSEKMKETNMKDRSLPKALGNEIVV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
143		GlycoProtDB
144		GlycoProtDB
147	N-linked (GlcNAc...) asparagine	GlycoProtDB UniProt
198		GlycoProtDB

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Cell surface interactions at the vascular wall	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements