GlyCosmos Portal

Submissions

Dual oxidase maturation factor 1

Summary

UniProt ID: Q1HG43
Gene Symbol: DUOXA1 NIP NUMBIP
Gene ID: 90527
Organism: Homo sapiens (human)

External Links

Re-Glyco: Q1HG43

Annotation

Keyword: 3D-structure Alternative splicing Cell membrane Disulfide bond Glycoprotein Protein transport Proteomics identification Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
protein localization	IGI	PMID PMID
intracellular protein localization	IGI	PMID PMID
positive regulation of hydrogen peroxide biosynthetic process	IMP	PMID
protein transport	IEA	GO_REF
hydrogen peroxide metabolic process

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

reactive oxygen species metabolic process [inference]

hydrogen peroxide metabolic process

localization [inference]

macromolecule localization [inference]

intracellular protein localization

protein transport

establishment of localization [inference]

transport [inference]

protein transport

establishment of protein localization [inference]

protein transport

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of reactive oxygen species biosynthetic process [inference]

positive regulation of hydrogen peroxide biosynthetic process

positive regulation of reactive oxygen species metabolic process [inference]

positive regulation of reactive oxygen species biosynthetic process [inference]

positive regulation of hydrogen peroxide biosynthetic process

positive regulation of cell differentiation [inference]

positive regulation of neuron differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of neuron differentiation

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

regulation of inflammatory response

regulation of response to stress [inference]

regulation of defense response [inference]

regulation of inflammatory response

regulation of developmental process [inference]

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of neuron differentiation

regulation of neuron differentiation [inference]

positive regulation of neuron differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of neuron differentiation

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of reactive oxygen species biosynthetic process [inference]

positive regulation of hydrogen peroxide biosynthetic process

regulation of reactive oxygen species biosynthetic process [inference]

regulation of hydrogen peroxide biosynthetic process [inference]

positive regulation of hydrogen peroxide biosynthetic process

positive regulation of reactive oxygen species biosynthetic process [inference]

positive regulation of hydrogen peroxide biosynthetic process

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of reactive oxygen species biosynthetic process [inference]

positive regulation of hydrogen peroxide biosynthetic process

positive regulation of reactive oxygen species metabolic process [inference]

positive regulation of reactive oxygen species biosynthetic process [inference]

positive regulation of hydrogen peroxide biosynthetic process

regulation of hormone metabolic process [inference]

regulation of thyroid hormone generation

regulation of reactive oxygen species metabolic process [inference]

regulation of hydrogen peroxide metabolic process [inference]

regulation of hydrogen peroxide biosynthetic process [inference]

positive regulation of hydrogen peroxide biosynthetic process

regulation of reactive oxygen species biosynthetic process [inference]

regulation of hydrogen peroxide biosynthetic process [inference]

positive regulation of hydrogen peroxide biosynthetic process

positive regulation of reactive oxygen species biosynthetic process [inference]

positive regulation of hydrogen peroxide biosynthetic process

positive regulation of reactive oxygen species metabolic process [inference]

positive regulation of reactive oxygen species biosynthetic process [inference]

positive regulation of hydrogen peroxide biosynthetic process

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of neuron differentiation

regulation of neuron differentiation [inference]

positive regulation of neuron differentiation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of reactive oxygen species biosynthetic process [inference]

positive regulation of hydrogen peroxide biosynthetic process

positive regulation of reactive oxygen species metabolic process [inference]

positive regulation of reactive oxygen species biosynthetic process [inference]

positive regulation of hydrogen peroxide biosynthetic process

positive regulation of cell differentiation [inference]

positive regulation of neuron differentiation

regulation of biological quality [inference]

regulation of hormone levels [inference]

regulation of hormone metabolic process [inference]

regulation of thyroid hormone generation

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
endoplasmic reticulum	IDA	PMID
endoplasmic reticulum membrane	IEA	GO_REF
plasma membrane	TAS	Reactome Reactome Reactome Reactome Reactome Reactome
plasma membrane	IDA	PMID
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

plasma membrane

organelle membrane [inference]

endoplasmic reticulum membrane

cell leading edge

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

Displaying 1 entry
GO Term	Evidence Code	Reference
enzyme binding	IPI	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

enzyme binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MATLGHTFPFYAGPKPTFPMDTTLASIIMIFLTALATFIVILPGIRGKTRLFWLLRVVTSLFIGAAILAVNFSSEWSVGQVSTNTSYKAFSSEWISADIGLQVGLGGVNITLTGTPVQQLNETINYNEEFTWRLGENYAEEYAKALEKGLPDPVLYLAEKFTPRSPCGLYRQYRLAGHYTSAMLWVAFLCWLLANVMLSMPVLVYGGYMLLATGIFQLLALLFFSMATSLTSPCPLHLGASVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLKAFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYCKEAHPKDPDCAL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	PubMed ID	Source
84	N-linked (GlcNAc...) asparagine	33420071	UniProt
109	N-linked (GlcNAc...) asparagine	33420071	UniProt
121	N-linked (GlcNAc...) asparagine	33420071	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Thyroxine biosynthesis	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements