GlyCosmos Portal

Submissions

Non-structural glycoprotein 4

Summary

UniProt ID: Q1WEV6
Gene Symbol: NSP4
Gene ID
Organism: Rotavirus G9

External Links

Re-Glyco: Q1WEV6

Annotation

Keyword: Activation of host autophagy by virus Calcium Coiled coil Enterotoxin Glycoprotein Host endoplasmic reticulum Host membrane Metal-binding Secreted Signal-anchor Transmembrane helix Viral ion channel Virulence

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
viral process	IEA	GO_REF
monoatomic ion transmembrane transport	IEA	GO_REF
ion transmembrane transport	IEA	GO_REF
symbiont-mediated activation of host autophagy	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

transmembrane transport [inference]

monoatomic ion transmembrane transport

viral process

biological process involved in interspecies interaction between organisms [inference]

modulation of process of another organism [inference]

symbiont-mediated perturbation of host process [inference]

symbiont-mediated perturbation of host cellular process [inference]

symbiont-mediated perturbation of host autophagy [inference]

symbiont-mediated activation of host autophagy

biological process involved in symbiotic interaction [inference]

biological process involved in interaction with host [inference]

symbiont-mediated perturbation of host process [inference]

symbiont-mediated perturbation of host cellular process [inference]

symbiont-mediated perturbation of host autophagy [inference]

symbiont-mediated activation of host autophagy

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic ion transmembrane transport

transmembrane transport [inference]

monoatomic ion transmembrane transport

Displaying **all 4** entries
GO Term	Evidence Code	Reference
extracellular region	IEA	GO_REF GO_REF
membrane	IEA	GO_REF
host caveola	IEA	GO_REF GO_REF
host cell rough endoplasmic reticulum membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

other organism part [inference]

host cellular component [inference]

host cell part [inference]

host cell membrane [inference]

host cell endoplasmic reticulum membrane [inference]

host cell rough endoplasmic reticulum membrane

host caveola

Displaying **all 3** entries
GO Term	Evidence Code	Reference
channel activity	IEA	GO_REF
metal ion binding	IEA	GO_REF GO_REF
toxin activity	IEA	GO_REF GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

passive transmembrane transporter activity [inference]

channel activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

toxin activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDKLADLNYTLSVITLMNDTLYSIIQDPGMAYFPYIASVLTVLFTLHKASIPTMKIALKTSKWSYKVIKYWIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEWESGKNPYEPIEVTASM

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites