GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Putative metalloproteinase inhibitor tag-225

Summary

UniProt ID: Q21265
Gene Symbol: tag-225 K07C11.5
Gene ID
Organism: Caenorhabditis elegans

External Links

GlycoProtDB: GPDB0000742
Re-Glyco: Q21265

Annotation

Keyword: Disulfide bond Glycoprotein Metal-binding Metalloprotease inhibitor Reference proteome Secreted Signal Zinc

Gene Ontology (GO)

Displaying 1 entry
GO Term	Evidence Code	Reference
negative regulation of membrane protein ectodomain proteolysis	IBA	GO_REF

GO Hierarchy

biological process

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of cellular process [inference]

regulation of metabolic process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of catabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

negative regulation of proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

negative regulation of proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of protein catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

regulation of membrane protein ectodomain proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein catabolic process [inference]

negative regulation of membrane protein ectodomain proteolysis

negative regulation of proteolysis [inference]

negative regulation of membrane protein ectodomain proteolysis

Displaying **all 2** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
extracellular matrix	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

external encapsulating structure [inference]

extracellular matrix

Displaying **all 3** entries
GO Term	Evidence Code	Reference
metalloendopeptidase inhibitor activity	IBA	GO_REF
metalloendopeptidase inhibitor activity	IEA	GO_REF
metal ion binding

GO Hierarchy

molecular function

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

peptidase regulator activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

endopeptidase regulator activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

molecular function inhibitor activity [inference]

enzyme inhibitor activity [inference]

peptidase inhibitor activity [inference]

endopeptidase inhibitor activity [inference]

metalloendopeptidase inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MQNLSLSLVILSVLIAVTLACKCREQSTKESFCNAHWVSHVKVKVRVGKQGLPEGSERKGLNNLRYTVQHVEVFKKPSNMTTLPDEIFTPSEAPACGLKIAAGHEYLLAGRVEGPNALYTVLCGQVLPDDRSQTSFENVLEWKNVPQTLQSQVKSIKC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
79	N-linked (GlcNAc...) asparagine	12754521 17761667		GlycoProtDB UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
Activation of Matrix Metalloproteinases	Caenorhabditis elegans
Neutrophil degranulation	Caenorhabditis elegans
Platelet degranulation	Caenorhabditis elegans
Post-translational protein phosphorylation	Caenorhabditis elegans
Regulation of IGF Activity by IGFBP	Caenorhabditis elegans

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026