GlyCosmos Portal

Submissions

NRAMP-like transporter smf-1

Summary

UniProt ID: Q21434
Gene Symbol: K11G12.4 smf-1
Gene ID: 180939
Organism: Caenorhabditis elegans

External Links

PubChem: Q21434
Re-Glyco: Q21434

Annotation

Keyword: Cell membrane Cytoplasmic vesicle Glycoprotein Ion transport Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
transition metal ion transport	ISS	PMID
manganese ion transport
intracellular iron ion homeostasis	IMP	PMID
intracellular iron ion homeostasis	IBA	GO_REF
response to metal ion	IGI	PMID

GO Hierarchy

biological process

cellular process [inference]

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

iron ion transmembrane transport

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

monoatomic cation homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

manganese ion homeostasis

intracellular manganese ion homeostasis

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

inorganic ion homeostasis [inference]

intracellular iron ion homeostasis

manganese ion homeostasis

intracellular manganese ion homeostasis

response to stimulus [inference]

response to chemical [inference]

response to metal ion

response to manganese ion

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport [inference]

metal ion transport [inference]

transition metal ion transport

iron ion transport [inference]

iron ion transmembrane transport

manganese ion transport

monoatomic cation transmembrane transport [inference]

iron ion transmembrane transport

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

iron ion transmembrane transport

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

iron ion transmembrane transport

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cellular response to manganese ion

negative regulation of response to stimulus [inference]

negative regulation of cellular response to manganese ion

regulation of response to stimulus [inference]

negative regulation of response to stimulus [inference]

negative regulation of cellular response to manganese ion

regulation of cellular response to manganese ion [inference]

negative regulation of cellular response to manganese ion

regulation of cellular process [inference]

negative regulation of cellular process [inference]

negative regulation of cellular response to manganese ion

regulation of cellular response to manganese ion [inference]

negative regulation of cellular response to manganese ion

Displaying **all 4** entries
GO Term	Evidence Code	Reference
plasma membrane
endosome membrane	IBA	GO_REF
apical plasma membrane	IDA	PMID
apical plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane

bounding membrane of organelle [inference]

endosome membrane

plasma membrane region [inference]

apical plasma membrane

Displaying **all 3** entries
GO Term	Evidence Code	Reference
iron ion transmembrane transporter activity	IBA	GO_REF
manganese ion transmembrane transporter activity
transition metal ion transmembrane transporter activity	ISS	PMID

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity [inference]

metal ion transmembrane transporter activity [inference]

transition metal ion transmembrane transporter activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MASSNNDGPIEPEAEPWRITQNDHLEQDLLEEDAESQERVDIPVDDVEKAFSFKKLWAFTGPGFLMSIAYLDPGNIESDLQSGAQAAYKLLWVLLSAHIIGMLLQRMSARLGVVSGKHMAEVAYQFYPRLPRIILWLMIEIAIVCSDMQEVIGTAIAIFLLSKGFVPLYVGVFITILDTFTFLLIDRYGIRKLELIFGFLILTMTVSFGYEFVVVKPPIGEVISGMVVPWCAGCGKGEFMQAISVVGAVIMPHNLYLHSALVKSRRVDRKDRRRVAEANKYFTLESAIALFLSFFINLFVVAVFAHGLYQKTNADVREMCIARHDIPDADIFPNNTEPVEVDIYKGGIYLGCQFGAIAMFIWGIGIFAAGQSSTMTGTYTGQFVMEGFVKIEWPKWKRVLITRAIAITPTLVLTFYSQGVQNLTGMNDFLNCVQMIQLPFALIPIITFTSSRKIMHDFRSSKVFQIFALITSALILSINVYFISDYVFSRLGSEWYIIMVLAPITFAYVLFVLYLALYCLVSCEIIPDTVSIRGFSFNKSYENDAPWLAVDSSAVHDNAGYQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
334	N-linked (GlcNAc...) asparagine			UniProt
422	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
Ion influx/efflux at host-pathogen interface	Caenorhabditis elegans
Iron uptake and transport	Caenorhabditis elegans
Metal ion SLC transporters	Caenorhabditis elegans
Neutrophil degranulation	Caenorhabditis elegans
ROS and RNS production in phagocytes	Caenorhabditis elegans

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements