GlyCosmos Portal

Submissions

Synapsin

Summary

UniProt ID: Q24546
Gene Symbol: CG3985 Dmel\CG3985 Dmel_CG3985 Dsyn-1 SYN SYN1 SYN2 Syn Syn-1 Syn-2 syn synapsin
Gene ID: 41247
Organism: Drosophila melanogaster (fruit fly)

External Links

GlyGen: Q24546
Re-Glyco: Q24546

Annotation

Keyword: Alternative splicing Behavior Direct protein sequencing Phosphoprotein Reference proteome Synapse

Gene Ontology (GO)

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
memory	IMP	PMID
male courtship behavior	IMP	PMID
associative learning	IMP	PMID
olfactory learning	IMP	PMID
response to heat	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

vesicle-mediated transport [inference]

exocytosis [inference]

regulated exocytosis [inference]

synaptic vesicle exocytosis

vesicle-mediated transport in synapse [inference]

synaptic vesicle exocytosis

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

cell junction assembly [inference]

synapse assembly [inference]

synaptic assembly at neuromuscular junction

cell junction organization [inference]

cell junction assembly [inference]

synapse assembly [inference]

synaptic assembly at neuromuscular junction

synapse organization

synapse assembly [inference]

synaptic assembly at neuromuscular junction

neuromuscular junction development [inference]

synaptic assembly at neuromuscular junction

presynapse organization [inference]

terminal button organization

export from cell [inference]

secretion by cell [inference]

exocytosis [inference]

regulated exocytosis [inference]

synaptic vesicle exocytosis

signal release [inference]

signal release from synapse [inference]

synaptic vesicle exocytosis

reproductive process [inference]

multicellular organismal reproductive process [inference]

reproductive behavior [inference]

mating behavior [inference]

courtship behavior [inference]

male courtship behavior

male mating behavior [inference]

male courtship behavior

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

cognition [inference]

learning or memory [inference]

learning [inference]

associative learning

olfactory learning

memory

behavior [inference]

learning or memory [inference]

learning [inference]

associative learning

olfactory learning

memory

visual behavior [inference]

optokinetic behavior [inference]

optomotor response

chemosensory behavior [inference]

olfactory behavior [inference]

olfactory learning

reproductive behavior [inference]

mating behavior [inference]

courtship behavior [inference]

male courtship behavior

male mating behavior [inference]

male courtship behavior

adult behavior [inference]

behavioral response to ethanol

growth [inference]

developmental growth [inference]

synaptic assembly at neuromuscular junction

response to stimulus [inference]

response to stress [inference]

response to heat

response to abiotic stimulus [inference]

response to temperature stimulus [inference]

response to heat

response to radiation [inference]

response to light stimulus [inference]

visual behavior [inference]

optokinetic behavior [inference]

optomotor response

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport [inference]

exocytosis [inference]

regulated exocytosis [inference]

synaptic vesicle exocytosis

vesicle-mediated transport in synapse [inference]

synaptic vesicle exocytosis

secretion [inference]

secretion by cell [inference]

exocytosis [inference]

regulated exocytosis [inference]

synaptic vesicle exocytosis

signal release [inference]

signal release from synapse [inference]

synaptic vesicle exocytosis

export from cell [inference]

secretion by cell [inference]

exocytosis [inference]

regulated exocytosis [inference]

synaptic vesicle exocytosis

signal release [inference]

signal release from synapse [inference]

synaptic vesicle exocytosis

establishment of localization in cell [inference]

synaptic vesicle exocytosis

organelle localization [inference]

vesicle localization [inference]

synaptic vesicle localization [inference]

synaptic vesicle clustering

Displaying **all 2** entries
GO Term	Evidence Code	Reference
synaptic vesicle membrane	IBA	GO_REF
terminal bouton	IDA	PMID PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

transport vesicle membrane [inference]

exocytic vesicle membrane [inference]

synaptic vesicle membrane

bounding membrane of organelle [inference]

transport vesicle membrane [inference]

exocytic vesicle membrane [inference]

synaptic vesicle membrane

presynapse [inference]

terminal bouton

Displaying 1 entry
GO Term	Evidence Code	Reference
ATP binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPPPPAPGQPAGAAPELSLSFGAGKTPATAAPAPPRGVSAPTSPAKSRESLLQRVQSLTGAARDQGASILGAAVQSATQRAPAFSKDKYFTLLVLDDQNTDWSKYFRGRRLHGDFDIRVEQAEFRDITVVSSADTGPVVTMAAYRSGTRVARSFRPDFVLIRQPPRDGSSDYRSTILGLKYGGVPSINSLHSIYQFQDKPWVFSHLLQLQRRLGRDGFPLIEQTFFPNPRDLFQFTKFPSVLKAGHCHGGVATARLENQSALQDAAGLVSGAGNDSHCYCTIEPYIDAKFSVHIQKIGNNYKAFMRKSITGNWKTNQGSAMLEQITLTEKYKSWVDEISELFGGMEVCGLSVVVAKDGREYIISACDSTFALIGDTQEEDRRQIADLVSGRMQNVCRPSMAQTGPGKLPSRSSVSSRAESPTDEGVAPTPPLPAGPRPAPMGGPPPIPERTSPAVGSIGRLSSRSSISEVPEEPSSSGPSTVGGVRRDSQTSQSSTISSSVSRAGQRPPQTQNSVVEDAEDTMKNLRKTFAGIFGDMXEIANKKRGRTASETSSGSGPGSVPSSAGPGSGFSSSFLGKQFSFAGKGEGVISTQPTQRPSEEPPAIPTTASSAVRPESSVSVSDSRNTDTLTERAGAGYQPVTNYEQQERVNPFDKEPSKSGSAASIHTSSSSSISSSSISSRINRNGNAIQSPPPPAGPPPPPPTNVTAVGSNANSSSGYRNSFSSSLSKDKTSYGNYGSTTSVETITRMDTNTTNIGATATEAGEASGVTAITNISNSDGIVAPTTGTITTSVTTNDWRSAIGMRSASVYSAPAAVTTVLPGDTSGYDSNSIASQGEGLNNPSDLPSYTRPSYSRSESNASKHSDLDVIFGDSKTTPASYGNGKYTRAAGSISDADMIFGGPPSNYKTDRFGASKSMSMTSGGVGSGNGSGSGLGGYKIYDSIQNAAFSDFSDSGSMSSIGSHTKRWSASKEEDDELDLK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
473				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Dopamine Neurotransmitter Release Cycle	Drosophila melanogaster
Serotonin Neurotransmitter Release Cycle	Drosophila melanogaster

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements