GlyCosmos Portal

Submissions

Beta-2 adrenergic receptor

Summary

UniProt ID

Q28044

Gene Symbol

ADRB2

Gene ID

281605

Organism

Bos taurus (domestic cattle)

External Links

PubChem: Q28044
Re-Glyco: Q28044

Annotation

Keyword: Cell membrane Disulfide bond Endosome G-protein coupled receptor Glycoprotein Golgi apparatus Hydroxylation Palmitate Phosphoprotein Reference proteome Transmembrane helix Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 40 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
diet induced thermogenesis
norepinephrine-epinephrine-mediated vasodilation involved in regulation of systemic arterial blood pressure	IBA	GO_REF
regulation of sodium ion transport
transcription by RNA polymerase II
receptor-mediated endocytosis	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

glutamate receptor signaling pathway [inference]

ionotropic glutamate receptor signaling pathway [inference]

AMPA selective glutamate receptor signaling pathway

G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-modulating G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-activating G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-activating adrenergic receptor signaling pathway

adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-inhibiting adrenergic receptor signaling pathway

adrenergic receptor signaling pathway [inference]

ligand-gated ion channel signaling pathway [inference]

ionotropic glutamate receptor signaling pathway [inference]

AMPA selective glutamate receptor signaling pathway

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

transcription by RNA polymerase II

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis

cellular developmental process [inference]

cell differentiation [inference]

fat cell differentiation [inference]

brown fat cell differentiation

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to amyloid-beta

cellular response to oxygen-containing compound [inference]

cellular response to amyloid-beta

multicellular organismal process [inference]

system process [inference]

muscle system process [inference]

muscle contraction [inference]

smooth muscle contraction

circulatory system process [inference]

vascular process in circulatory system [inference]

blood vessel diameter maintenance [inference]

vasodilation [inference]

norepinephrine-epinephrine-mediated vasodilation involved in regulation of systemic arterial blood pressure

multicellular organismal-level homeostasis [inference]

temperature homeostasis [inference]

heat generation

adaptive thermogenesis [inference]

diet induced thermogenesis

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

bone resorption

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

fat cell differentiation [inference]

brown fat cell differentiation

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

temperature homeostasis [inference]

heat generation

adaptive thermogenesis [inference]

diet induced thermogenesis

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

bone resorption

response to stimulus [inference]

response to stress [inference]

response to cold

response to abiotic stimulus [inference]

response to temperature stimulus [inference]

response to cold

response to chemical [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to amyloid-beta

cellular response to oxygen-containing compound [inference]

cellular response to amyloid-beta

response to nitrogen compound [inference]

cellular response to nitrogen compound [inference]

cellular response to amyloid-beta

response to amyloid-beta [inference]

cellular response to amyloid-beta

response to oxygen-containing compound [inference]

cellular response to oxygen-containing compound [inference]

cellular response to amyloid-beta

response to amyloid-beta [inference]

cellular response to amyloid-beta

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to amyloid-beta

cellular response to oxygen-containing compound [inference]

cellular response to amyloid-beta

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis

import into cell [inference]

endocytosis [inference]

receptor-mediated endocytosis

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of G protein-coupled receptor signaling pathway [inference]

negative regulation of G protein-coupled receptor signaling pathway

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

negative regulation of signal transduction [inference]

negative regulation of G protein-coupled receptor signaling pathway

modulation of excitatory postsynaptic potential [inference]

regulation of mini excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

positive regulation of excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

regulation of cAMP/PKA signal transduction [inference]

positive regulation of cAMP/PKA signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of G protein-coupled receptor signaling pathway

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

modulation of excitatory postsynaptic potential [inference]

regulation of mini excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

positive regulation of excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

regulation of localization [inference]

regulation of transport [inference]

regulation of monoatomic ion transport [inference]

regulation of metal ion transport [inference]

regulation of sodium ion transport

regulation of growth [inference]

negative regulation of growth [inference]

negative regulation of developmental growth [inference]

negative regulation of multicellular organism growth

regulation of developmental growth [inference]

regulation of multicellular organism growth [inference]

negative regulation of multicellular organism growth

negative regulation of developmental growth [inference]

negative regulation of multicellular organism growth

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of catabolic process [inference]

positive regulation of autophagy [inference]

positive regulation of macroautophagy [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of muscle cell apoptotic process [inference]

positive regulation of striated muscle cell apoptotic process [inference]

positive regulation of cardiac muscle cell apoptotic process

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of autophagosome maturation

positive regulation of protein-containing complex disassembly [inference]

positive regulation of autophagosome maturation

positive regulation of actin filament-based movement [inference]

positive regulation of cardiac muscle cell contraction

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

positive regulation of developmental process [inference]

positive regulation of biomineral tissue development [inference]

positive regulation of bone mineralization

positive regulation of multicellular organismal process [inference]

positive regulation of ossification [inference]

positive regulation of bone mineralization

positive regulation of cold-induced thermogenesis

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of G protein-coupled receptor signaling pathway

negative regulation of growth [inference]

negative regulation of developmental growth [inference]

negative regulation of multicellular organism growth

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of G protein-coupled receptor signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of G protein-coupled receptor signaling pathway

negative regulation of developmental process [inference]

negative regulation of developmental growth [inference]

negative regulation of multicellular organism growth

negative regulation of multicellular organismal process [inference]

negative regulation of multicellular organism growth

negative regulation of muscle contraction [inference]

negative regulation of smooth muscle contraction

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of G protein-coupled receptor signaling pathway [inference]

negative regulation of G protein-coupled receptor signaling pathway

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

negative regulation of signal transduction [inference]

negative regulation of G protein-coupled receptor signaling pathway

modulation of excitatory postsynaptic potential [inference]

regulation of mini excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

positive regulation of excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

regulation of cAMP/PKA signal transduction [inference]

positive regulation of cAMP/PKA signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of G protein-coupled receptor signaling pathway

regulation of developmental process [inference]

regulation of developmental growth [inference]

regulation of multicellular organism growth [inference]

negative regulation of multicellular organism growth

negative regulation of developmental growth [inference]

negative regulation of multicellular organism growth

negative regulation of developmental process [inference]

negative regulation of developmental growth [inference]

negative regulation of multicellular organism growth

positive regulation of developmental process [inference]

positive regulation of biomineral tissue development [inference]

positive regulation of bone mineralization

regulation of multicellular organismal development [inference]

regulation of biomineral tissue development [inference]

regulation of bone mineralization [inference]

positive regulation of bone mineralization

positive regulation of biomineral tissue development [inference]

positive regulation of bone mineralization

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

glutamate receptor signaling pathway [inference]

ionotropic glutamate receptor signaling pathway [inference]

AMPA selective glutamate receptor signaling pathway

G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-modulating G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-activating G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-activating adrenergic receptor signaling pathway

adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-inhibiting adrenergic receptor signaling pathway

adrenergic receptor signaling pathway [inference]

ligand-gated ion channel signaling pathway [inference]

ionotropic glutamate receptor signaling pathway [inference]

AMPA selective glutamate receptor signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of G protein-coupled receptor signaling pathway [inference]

negative regulation of G protein-coupled receptor signaling pathway

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

negative regulation of signal transduction [inference]

negative regulation of G protein-coupled receptor signaling pathway

modulation of excitatory postsynaptic potential [inference]

regulation of mini excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

positive regulation of excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

regulation of cAMP/PKA signal transduction [inference]

positive regulation of cAMP/PKA signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of G protein-coupled receptor signaling pathway

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

modulation of excitatory postsynaptic potential [inference]

regulation of mini excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

positive regulation of excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of catabolic process [inference]

positive regulation of autophagy [inference]

positive regulation of macroautophagy [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of catabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of autophagy [inference]

positive regulation of macroautophagy [inference]

regulation of autophagy [inference]

positive regulation of autophagy [inference]

positive regulation of macroautophagy [inference]

regulation of macroautophagy [inference]

positive regulation of macroautophagy [inference]

regulation of autophagosome maturation [inference]

positive regulation of autophagosome maturation

regulation of lipophagy [inference]

positive regulation of lipophagy

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of actin filament-based process [inference]

regulation of actin filament-based movement [inference]

regulation of cardiac muscle cell contraction [inference]

positive regulation of cardiac muscle cell contraction

positive regulation of actin filament-based movement [inference]

positive regulation of cardiac muscle cell contraction

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

regulation of muscle cell apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

positive regulation of muscle cell apoptotic process [inference]

positive regulation of striated muscle cell apoptotic process [inference]

positive regulation of cardiac muscle cell apoptotic process

regulation of striated muscle cell apoptotic process [inference]

positive regulation of striated muscle cell apoptotic process [inference]

positive regulation of cardiac muscle cell apoptotic process

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

regulation of cardiac muscle cell apoptotic process [inference]

positive regulation of apoptotic process [inference]

positive regulation of muscle cell apoptotic process [inference]

positive regulation of striated muscle cell apoptotic process [inference]

positive regulation of cardiac muscle cell apoptotic process

negative regulation of apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of muscle cell apoptotic process [inference]

positive regulation of striated muscle cell apoptotic process [inference]

positive regulation of cardiac muscle cell apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of catabolic process [inference]

positive regulation of autophagy [inference]

positive regulation of macroautophagy [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of muscle cell apoptotic process [inference]

positive regulation of striated muscle cell apoptotic process [inference]

positive regulation of cardiac muscle cell apoptotic process

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of autophagosome maturation

positive regulation of protein-containing complex disassembly [inference]

positive regulation of autophagosome maturation

positive regulation of actin filament-based movement [inference]

positive regulation of cardiac muscle cell contraction

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of G protein-coupled receptor signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of autophagosome maturation

regulation of autophagosome maturation [inference]

positive regulation of autophagosome maturation

regulation of protein-containing complex disassembly [inference]

positive regulation of protein-containing complex disassembly [inference]

positive regulation of autophagosome maturation

regulation of autophagosome maturation [inference]

positive regulation of autophagosome maturation

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of autophagosome maturation

positive regulation of protein-containing complex disassembly [inference]

positive regulation of autophagosome maturation

regulation of multicellular organismal process [inference]

regulation of ossification [inference]

regulation of bone mineralization [inference]

positive regulation of bone mineralization

positive regulation of ossification [inference]

positive regulation of bone mineralization

regulation of multicellular organism growth [inference]

negative regulation of multicellular organism growth

regulation of system process [inference]

regulation of nervous system process [inference]

modulation of excitatory postsynaptic potential [inference]

regulation of mini excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

positive regulation of excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

regulation of muscle system process [inference]

regulation of muscle contraction [inference]

regulation of smooth muscle contraction [inference]

negative regulation of smooth muscle contraction

regulation of striated muscle contraction [inference]

regulation of cardiac muscle contraction [inference]

regulation of cardiac muscle cell contraction [inference]

positive regulation of cardiac muscle cell contraction

negative regulation of muscle contraction [inference]

negative regulation of smooth muscle contraction

regulation of blood circulation [inference]

regulation of heart contraction [inference]

regulation of cardiac muscle contraction [inference]

regulation of cardiac muscle cell contraction [inference]

positive regulation of cardiac muscle cell contraction

positive regulation of multicellular organismal process [inference]

positive regulation of ossification [inference]

positive regulation of bone mineralization

positive regulation of cold-induced thermogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of multicellular organism growth

negative regulation of muscle contraction [inference]

negative regulation of smooth muscle contraction

regulation of cold-induced thermogenesis [inference]

positive regulation of cold-induced thermogenesis

regulation of multicellular organismal development [inference]

regulation of biomineral tissue development [inference]

regulation of bone mineralization [inference]

positive regulation of bone mineralization

positive regulation of biomineral tissue development [inference]

positive regulation of bone mineralization

regulation of biological quality [inference]

regulation of blood pressure [inference]

negative regulation of blood pressure [inference]

negative regulation of systemic arterial blood pressure [inference]

norepinephrine-epinephrine-mediated vasodilation involved in regulation of systemic arterial blood pressure

regulation of membrane potential [inference]

modulation of excitatory postsynaptic potential [inference]

regulation of mini excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

positive regulation of excitatory postsynaptic potential [inference]

positive regulation of mini excitatory postsynaptic potential

regulation of anatomical structure size [inference]

regulation of tube size [inference]

regulation of tube diameter [inference]

blood vessel diameter maintenance [inference]

vasodilation [inference]

norepinephrine-epinephrine-mediated vasodilation involved in regulation of systemic arterial blood pressure

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	IEA	GO_REF
early endosome	ISS	GO_REF
early endosome	IEA	GO_REF
Golgi apparatus	ISS	GO_REF
Golgi apparatus	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex

cellular anatomical structure [inference]

microtubule organizing center [inference]

ciliary basal body

membrane [inference]

plasma membrane

plasma membrane region [inference]

apical plasma membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

secretory vesicle [inference]

secretory granule [inference]

dense core granule [inference]

neuronal dense core vesicle

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

secretory vesicle [inference]

secretory granule [inference]

dense core granule [inference]

neuronal dense core vesicle

membraneless organelle [inference]

intracellular membraneless organelle [inference]

spindle [inference]

mitotic spindle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

secretory vesicle [inference]

secretory granule [inference]

dense core granule [inference]

neuronal dense core vesicle

intracellular membraneless organelle [inference]

spindle [inference]

mitotic spindle

intercellular bridge

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
amyloid-beta binding	IEA	GO_REF
beta2-adrenergic receptor activity	ISS	GO_REF
beta2-adrenergic receptor activity	IBA	GO_REF
beta2-adrenergic receptor activity	IEA	GO_REF GO_REF
adenylate cyclase binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

enzyme binding [inference]

adenylate cyclase binding

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

norepinephrine binding

peptide binding [inference]

amyloid-beta binding

protein-containing complex binding

catecholamine binding [inference]

norepinephrine binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity [inference]

G protein-coupled amine receptor activity [inference]

adrenergic receptor activity [inference]

beta-adrenergic receptor activity [inference]

beta2-adrenergic receptor activity

molecular function regulator activity [inference]

transporter regulator activity [inference]

channel regulator activity [inference]

ion channel regulator activity [inference]

potassium channel regulator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGQPGNRSVFLLAPNASHAPDQNVTLERDEAWVVGMGILMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGACHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYLAITSPFKYQCLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRASHKEAINCYAKETCCDFFTNQPYAIASSIVSFYLPLVVMVFVYSRVFQVAKRQLQKIDKSEGRFHAQNVSQVEQDGRSGLGQRRTSKFYLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIKDNLIRKEIYILLNWLGYINSAFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGCSSNSNDRTDYTGEQSGYHLGEEKDSELLCEDPPGTENFVNQQGTVPSDSIDSQGRNCSTNDSLL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
6	N-linked (GlcNAc...) asparagine	UniProt
15	N-linked (GlcNAc...) asparagine	UniProt
23	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
Adrenoceptors	Bos taurus
Cargo recognition for clathrin-mediated endocytosis	Bos taurus
Clathrin-mediated endocytosis	Bos taurus
G alpha (s) signalling events	Bos taurus
Ub-specific processing proteases	Bos taurus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements