GlyCosmos Portal

Submissions

Tumor necrosis factor receptor superfamily member 5

Summary

UniProt ID

Q28203

Gene Symbol

CD40
TNFRSF5

Gene ID

286849

Organism

Bos taurus (domestic cattle)

External Links

PubChem: Q28203
Re-Glyco: Q28203

Annotation

Keyword: Disulfide bond Glycoprotein Immunity Receptor Reference proteome Repeat Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
immune response-regulating cell surface receptor signaling pathway	IBA	GO_REF
intracellular calcium ion homeostasis	IEA	GO_REF
defense response	IEA	GO_REF
regulation of gene expression	IEA	GO_REF
positive regulation of macromolecule biosynthetic process

GO Hierarchy

biological process

immune system process [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

B cell activation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

B cell activation

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway

cell surface receptor signaling pathway [inference]

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

B cell activation

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis

monoatomic cation homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis

calcium ion homeostasis [inference]

intracellular calcium ion homeostasis

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis

inorganic ion homeostasis [inference]

calcium ion homeostasis [inference]

intracellular calcium ion homeostasis

response to stimulus [inference]

response to stress [inference]

defense response

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process

regulation of response to stimulus [inference]

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway

regulation of developmental process [inference]

positive regulation of developmental process

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway

cell surface receptor signaling pathway [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process

regulation of macromolecule biosynthetic process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process

Displaying **all 3** entries
GO Term	Evidence Code	Reference
external side of plasma membrane	IBA	GO_REF
external side of plasma membrane	IEA	GO_REF
CD40 receptor complex	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex [inference]

plasma membrane signaling receptor complex [inference]

CD40 receptor complex

membrane protein complex [inference]

plasma membrane protein complex [inference]

plasma membrane signaling receptor complex [inference]

CD40 receptor complex

cellular anatomical structure [inference]

side of membrane [inference]

external side of plasma membrane

Displaying 1 entry
GO Term	Evidence Code	Reference
signaling receptor activity	IEA	GO_REF

GO Hierarchy

molecular function

molecular transducer activity [inference]

signaling receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVRLPLQCLFWGFFLTAVHSEPATACGEKQYPVNSLCCDLCPPGQKLVNDCTEVSKTECQSCGKGEFLSTWNREKYCHEHRYCNPNLGLRIQSEGTLNTDTTCVCVEGQHCTSHTCESCTPHSLCLPGFGVKQIATGLLDTVCEPCPLGFFSNVSSAFEKCHRWTSCERKGLVEQHVGTNKTDVVCGFQSRMRTLVVIPVTMGVLFAVLLVSACIRNITKKRQAKALHPTAERQDPVETIDPEDFPGPHPPPPVQETLCWCQPVAQEDGKESRISVQERE

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
153	N-linked (GlcNAc...) asparagine			UniProt
180	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell	Bos taurus
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway	Bos taurus
TNFR2 non-canonical NF-kB pathway	Bos taurus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements