GlyCosmos Portal

Submissions

Granulocyte-macrophage colony-stimulating factor

Summary

UniProt ID: Q29118
Gene Symbol: CSF2
Gene ID: 397208
Organism: Sus scrofa (pig)

External Links

PubChem: Q29118
Re-Glyco: Q29118

Annotation

Keyword: Cytokine Disulfide bond Glycoprotein Growth factor Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
immune response	IEA	GO_REF
myeloid cell differentiation	IBA	GO_REF
TOR signaling	IMP	PMID
positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	PMID
positive regulation of ERK1 and ERK2 cascade	IMP	PMID

GO Hierarchy

biological process

immune system process [inference]

immune response

cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

TOR signaling

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

gene expression [inference]

cytokine production [inference]

type I interferon production [inference]

interferon-tau production

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression [inference]

cytokine production [inference]

type I interferon production [inference]

interferon-tau production

cellular developmental process [inference]

cell differentiation [inference]

myeloid cell differentiation

multicellular organismal process [inference]

cytokine production [inference]

type I interferon production [inference]

interferon-tau production

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

myeloid cell differentiation

response to stimulus [inference]

immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of growth [inference]

regulation of developmental growth [inference]

regulation of trophectodermal cell proliferation [inference]

positive regulation of trophectodermal cell proliferation

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of trophectodermal cell proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of developmental process [inference]

regulation of developmental growth [inference]

regulation of trophectodermal cell proliferation [inference]

positive regulation of trophectodermal cell proliferation

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

TOR signaling

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of trophectodermal cell proliferation

regulation of trophectodermal cell proliferation [inference]

positive regulation of trophectodermal cell proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of trophectodermal cell proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying **all 4** entries
GO Term	Evidence Code	Reference
cytokine activity	ISS	GO_REF
cytokine activity	IBA	GO_REF
granulocyte macrophage colony-stimulating factor receptor binding	IEA	GO_REF
growth factor activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

granulocyte macrophage colony-stimulating factor receptor binding

growth factor receptor binding [inference]

granulocyte macrophage colony-stimulating factor receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MWLQNLLLLGTVVCSISAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	Source
24	O-linked (GalNAc...) serine	UniProt
27	O-linked (GalNAc...) threonine	UniProt
44	N-linked (GlcNAc...) asparagine	UniProt
47	N-linked (GlcNAc...) asparagine	UniProt
54	N-linked (GlcNAc...) asparagine	UniProt